PDB entry 2r9i

View 2r9i on RCSB PDB site
Description: Crystal structure of putative phage capsid protein domain from Corynebacterium diphtheriae
Deposited on 2007-09-12, released 2007-12-18
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.22
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative phage capsid protein
    Species: Corynebacterium diphtheriae NCTC 13129 [TaxId:257309]
    Gene: DIP0205
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2r9iA (A:)
    snamnlkdllahrenlmdsakrarsaitddmdpadaaqavenvksiiseiestdeaiaar
    rgvsdvtqklkgltitergtendsaasrslgehfvkaagdrlknqaagahieysvpeyqv
    kedahsspkdlvegwgtfyqr
    

    Sequence, based on observed residues (ATOM records):
    >2r9iA (A:)
    mnlkdllahrenlmdsakrarsaitddmdpadaaqavenvksiiseiestdeaiaarrgv
    sdvtqklkglti