PDB entry 2r9h

View 2r9h on RCSB PDB site
Description: Crystal Structure of Q207C Mutant of CLC-ec1 in complex with Fab
Class: membrane protein
Keywords: CLC, antiporter, transporter, exchanger, disulfide, crosslink, membrane protein, Chloride, Inner membrane, Ion transport, Stress response, Transmembrane
Deposited on 2007-09-12, released 2007-11-20
The last revision prior to the SCOP 1.75 freeze date was dated 2007-11-20, with a file datestamp of 2007-11-16.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.262
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H(+)/Cl(-) exchange transporter clcA
    Species: ESCHERICHIA COLI
    Gene: clcA, eriC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37019 (0-443)
      • engineered (190)
  • Chain 'B':
    Compound: H(+)/Cl(-) exchange transporter clcA
    Species: ESCHERICHIA COLI
    Gene: clcA, eriC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37019
      • engineered (190)
  • Chain 'C':
    Compound: fab fragment
    Species: ESCHERICHIA COLI
  • Chain 'D':
    Compound: fab fragment
    Species: ESCHERICHIA COLI
    Domains in SCOP 1.75: d2r9hd1, d2r9hd2
  • Chain 'E':
    Compound: fab fragment
    Species: ESCHERICHIA COLI
  • Chain 'F':
    Compound: fab fragment
    Species: ESCHERICHIA COLI
    Domains in SCOP 1.75: d2r9hf1, d2r9hf2
  • Heterogens: CL

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2r9hD (D:)
    divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
    fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleilradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnra
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2r9hF (F:)
    divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
    fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleilradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnra