PDB entry 2r9g

View 2r9g on RCSB PDB site
Description: Crystal structure of the C-terminal fragment of AAA ATPase from Enterococcus faecium
Class: hydrolase
Keywords: STRUCTURAL GENOMICS, ATPASE, PSI-2, PROTEIN STRUCTURE INITIATIVE, New York SGX Research Center for Structural Genomics, NYSGXRC, ATP-BINDING, NUCLEOTIDE-BINDING, HYDROLASE
Deposited on 2007-09-12, released 2007-10-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: 0.199
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AAA ATPase, central region
    Species: Enterococcus faecium [TaxId:333849]
    Gene: EfaeDRAFT_0938
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3XY27 (Start-195)
      • expression tag (196)
    Domains in SCOPe 2.07: d2r9ga1, d2r9ga2
  • Chain 'B':
    Compound: AAA ATPase, central region
    Species: Enterococcus faecium [TaxId:333849]
    Gene: EfaeDRAFT_0938
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3XY27 (Start-195)
      • expression tag (196)
    Domains in SCOPe 2.07: d2r9gb2, d2r9gb3
  • Chain 'C':
    Compound: AAA ATPase, central region
    Species: Enterococcus faecium [TaxId:333849]
    Gene: EfaeDRAFT_0938
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3XY27 (Start-195)
      • expression tag (196)
    Domains in SCOPe 2.07: d2r9gc1, d2r9gc2
  • Chain 'D':
    Compound: AAA ATPase, central region
    Species: Enterococcus faecium [TaxId:333849]
    Gene: EfaeDRAFT_0938
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3XY27 (Start-195)
      • expression tag (196)
    Domains in SCOPe 2.07: d2r9gd2, d2r9gd3
  • Chain 'E':
    Compound: AAA ATPase, central region
    Species: Enterococcus faecium [TaxId:333849]
    Gene: EfaeDRAFT_0938
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3XY27 (Start-195)
      • expression tag (196)
    Domains in SCOPe 2.07: d2r9ge2, d2r9ge3
  • Chain 'F':
    Compound: AAA ATPase, central region
    Species: Enterococcus faecium [TaxId:333849]
    Gene: EfaeDRAFT_0938
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3XY27 (Start-195)
      • expression tag (196)
    Domains in SCOPe 2.07: d2r9gf2, d2r9gf3
  • Chain 'G':
    Compound: AAA ATPase, central region
    Species: Enterococcus faecium [TaxId:333849]
    Gene: EfaeDRAFT_0938
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3XY27 (Start-195)
      • expression tag (196)
    Domains in SCOPe 2.07: d2r9gg2, d2r9gg3
  • Chain 'H':
    Compound: AAA ATPase, central region
    Species: Enterococcus faecium [TaxId:333849]
    Gene: EfaeDRAFT_0938
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3XY27 (Start-195)
      • expression tag (196)
    Domains in SCOPe 2.07: d2r9gh2, d2r9gh3
  • Chain 'I':
    Compound: AAA ATPase, central region
    Species: Enterococcus faecium [TaxId:333849]
    Gene: EfaeDRAFT_0938
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3XY27 (Start-195)
      • expression tag (196)
    Domains in SCOPe 2.07: d2r9gi2, d2r9gi3
  • Chain 'J':
    Compound: AAA ATPase, central region
    Species: Enterococcus faecium [TaxId:333849]
    Gene: EfaeDRAFT_0938
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3XY27 (Start-195)
      • expression tag (196)
    Domains in SCOPe 2.07: d2r9gj2, d2r9gj3
  • Chain 'K':
    Compound: AAA ATPase, central region
    Species: Enterococcus faecium [TaxId:333849]
    Gene: EfaeDRAFT_0938
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3XY27 (Start-195)
      • expression tag (196)
    Domains in SCOPe 2.07: d2r9gk2, d2r9gk3
  • Chain 'L':
    Compound: AAA ATPase, central region
    Species: Enterococcus faecium [TaxId:333849]
    Gene: EfaeDRAFT_0938
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3XY27 (3-195)
      • expression tag (196)
    Domains in SCOPe 2.07: d2r9gl2, d2r9gl3
  • Chain 'M':
    Compound: AAA ATPase, central region
    Species: Enterococcus faecium [TaxId:333849]
    Gene: EfaeDRAFT_0938
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3XY27 (Start-195)
      • expression tag (196)
    Domains in SCOPe 2.07: d2r9gm2, d2r9gm3
  • Chain 'N':
    Compound: AAA ATPase, central region
    Species: Enterococcus faecium [TaxId:333849]
    Gene: EfaeDRAFT_0938
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3XY27 (Start-195)
      • expression tag (196)
    Domains in SCOPe 2.07: d2r9gn2, d2r9gn3
  • Chain 'O':
    Compound: AAA ATPase, central region
    Species: Enterococcus faecium [TaxId:333849]
    Gene: EfaeDRAFT_0938
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3XY27 (Start-195)
      • expression tag (196)
    Domains in SCOPe 2.07: d2r9go2, d2r9go3
  • Chain 'P':
    Compound: AAA ATPase, central region
    Species: Enterococcus faecium [TaxId:333849]
    Gene: EfaeDRAFT_0938
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3XY27 (3-195)
      • expression tag (196)
    Domains in SCOPe 2.07: d2r9gp2, d2r9gp3
  • Heterogens: ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r9gA (A:)
    mslalthdkngdahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyed
    iglgnpaaaartvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladire
    gkagdvpdhlrdshykgakslnrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgk
    yeqalgqqyyrikewkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r9gA (A:)
    dahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyediglgnpaaaar
    tvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladiregkagdvpdhlr
    dshynrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgkyeqalgqqyyrikewke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2r9gB (B:)
    mslalthdkngdahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyed
    iglgnpaaaartvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladire
    gkagdvpdhlrdshykgakslnrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgk
    yeqalgqqyyrikewkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r9gB (B:)
    dahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyediglgnpaaaar
    tvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladiregkagdvpdhlr
    dshynrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgkyeqalgqqyyrikewke
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2r9gC (C:)
    mslalthdkngdahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyed
    iglgnpaaaartvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladire
    gkagdvpdhlrdshykgakslnrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgk
    yeqalgqqyyrikewkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r9gC (C:)
    dgdahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyediglgnpaaa
    artvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladiregkagdvpdh
    lrdshyknrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgkyeqalgqqyyrike
    wke
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2r9gD (D:)
    mslalthdkngdahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyed
    iglgnpaaaartvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladire
    gkagdvpdhlrdshykgakslnrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgk
    yeqalgqqyyrikewkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r9gD (D:)
    dahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyediglgnpaaaar
    tvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladiregkagdvpdhlr
    dshynrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgkyeqalgqqyyrikewke
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2r9gE (E:)
    mslalthdkngdahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyed
    iglgnpaaaartvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladire
    gkagdvpdhlrdshykgakslnrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgk
    yeqalgqqyyrikewkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r9gE (E:)
    dahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyediglgnpaaaar
    tvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladiregkagdvpdhlr
    dshyrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgkyeqalgqqyyrikewke
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2r9gF (F:)
    mslalthdkngdahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyed
    iglgnpaaaartvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladire
    gkagdvpdhlrdshykgakslnrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgk
    yeqalgqqyyrikewkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r9gF (F:)
    dahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyediglgnpaaaar
    tvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladiregkagdvpdhlr
    dshynrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgkyeqalgqqyyrikewke
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2r9gG (G:)
    mslalthdkngdahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyed
    iglgnpaaaartvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladire
    gkagdvpdhlrdshykgakslnrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgk
    yeqalgqqyyrikewkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r9gG (G:)
    dahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyediglgnpaaaar
    tvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladiregkagdvpdhlr
    dshyrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgkyeqalgqqyyrikewke
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2r9gH (H:)
    mslalthdkngdahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyed
    iglgnpaaaartvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladire
    gkagdvpdhlrdshykgakslnrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgk
    yeqalgqqyyrikewkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r9gH (H:)
    dahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyediglgnpaaaar
    tvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladiregkagdvpdhlr
    dshyrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgkyeqalgqqyyrikewke
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2r9gI (I:)
    mslalthdkngdahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyed
    iglgnpaaaartvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladire
    gkagdvpdhlrdshykgakslnrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgk
    yeqalgqqyyrikewkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r9gI (I:)
    dahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyediglgnpaaaar
    tvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladiregkagdvpdhlr
    dshygvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgkyeqalgqqyyrikewke
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2r9gJ (J:)
    mslalthdkngdahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyed
    iglgnpaaaartvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladire
    gkagdvpdhlrdshykgakslnrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgk
    yeqalgqqyyrikewkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r9gJ (J:)
    ngdahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyediglgnpaaa
    artvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladiregkagdvpdh
    lrdshyrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgkyeqalgqqyyrikewk
    e
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2r9gK (K:)
    mslalthdkngdahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyed
    iglgnpaaaartvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladire
    gkagdvpdhlrdshykgakslnrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgk
    yeqalgqqyyrikewkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r9gK (K:)
    dahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyediglgnpaaaar
    tvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladiregkagdvpdhlr
    dshynrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgkyeqalgqqyyrikewke
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2r9gL (L:)
    mslalthdkngdahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyed
    iglgnpaaaartvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladire
    gkagdvpdhlrdshykgakslnrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgk
    yeqalgqqyyrikewkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r9gL (L:)
    althdkngdahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyedigl
    gnpaaaartvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladiregka
    gdvpdhlrdshynrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgkyeqalgqqy
    yrikewke
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2r9gM (M:)
    mslalthdkngdahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyed
    iglgnpaaaartvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladire
    gkagdvpdhlrdshykgakslnrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgk
    yeqalgqqyyrikewkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r9gM (M:)
    dahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyediglgnpaaaar
    tvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladiregkagdvpdhlr
    dshyrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgkyeqalgqqyyrikewke
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2r9gN (N:)
    mslalthdkngdahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyed
    iglgnpaaaartvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladire
    gkagdvpdhlrdshykgakslnrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgk
    yeqalgqqyyrikewkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r9gN (N:)
    dahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyediglgnpaaaar
    tvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladiregkagdvpdhlr
    dshynrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgkyeqalgqqyyrikewke
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2r9gO (O:)
    mslalthdkngdahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyed
    iglgnpaaaartvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladire
    gkagdvpdhlrdshykgakslnrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgk
    yeqalgqqyyrikewkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r9gO (O:)
    gdahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyediglgnpaaaa
    rtvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladiregkagdvpdhl
    rdshyrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgkyeqalgqqyyrikewke
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2r9gP (P:)
    mslalthdkngdahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyed
    iglgnpaaaartvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladire
    gkagdvpdhlrdshykgakslnrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgk
    yeqalgqqyyrikewkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r9gP (P:)
    althdkngdahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyedigl
    gnpaaaartvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladiregka
    gdvpdhlrdshyrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgkyeqalgqqyy
    rikewke