PDB entry 2r9b

View 2r9b on RCSB PDB site
Description: Structural Analysis of Plasmepsin 2 from Plasmodium falciparum complexed with a peptide-based inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: beta fold aspartyl protease, glycoprotein, vacuole, zymogen, hydrolase-hydrolase inhibitor complex
Deposited on 2007-09-12, released 2007-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Plasmepsin-2
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: plasmepsin 2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2r9ba_
  • Chain 'B':
    Compound: Plasmepsin-2
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: plasmepsin 2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2r9bb_
  • Chain 'C':
    Compound: peptide-based inhibitor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2R9B (0-7)
  • Chain 'D':
    Compound: peptide-based inhibitor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2R9B (0-7)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2r9bA (A:)
    ssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlyds
    sksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastf
    dgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyeg
    pltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvp
    flpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfi
    lgdpfmrkyftvfdydnhsvgialakknl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2r9bB (B:)
    ssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlyds
    sksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastf
    dgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyeg
    pltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvp
    flpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfi
    lgdpfmrkyftvfdydnhsvgialakknl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.