PDB entry 2r8y

View 2r8y on RCSB PDB site
Description: Crystal structure of YrbI phosphatase from Escherichia coli in a complex with Ca
Class: hydrolase
Keywords: YrbI, phosphatase, divalent metal, ca, HAD superfamily, KDO8-P, HYDROLASE
Deposited on 2007-09-11, released 2008-09-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-11-03, with a file datestamp of 2009-10-30.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.215
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: YrbI from Escherichia coli
    Species: Escherichia coli [TaxId:562]
    Gene: yrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2r8ya_
  • Chain 'B':
    Compound: YrbI from Escherichia coli
    Species: Escherichia coli [TaxId:562]
    Gene: yrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2r8yb_
  • Chain 'C':
    Compound: YrbI from Escherichia coli
    Species: Escherichia coli [TaxId:562]
    Gene: yrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2r8yc_
  • Chain 'D':
    Compound: YrbI from Escherichia coli
    Species: Escherichia coli [TaxId:562]
    Gene: yrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2r8yd_
  • Chain 'E':
    Compound: YrbI from Escherichia coli
    Species: Escherichia coli [TaxId:562]
    Gene: yrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2r8ye_
  • Chain 'F':
    Compound: YrbI from Escherichia coli
    Species: Escherichia coli [TaxId:562]
    Gene: yrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2r8yf_
  • Chain 'G':
    Compound: YrbI from Escherichia coli
    Species: Escherichia coli [TaxId:562]
    Gene: yrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2r8yg_
  • Chain 'H':
    Compound: YrbI from Escherichia coli
    Species: Escherichia coli [TaxId:562]
    Gene: yrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2r8yh_
  • Chain 'I':
    Compound: YrbI from Escherichia coli
    Species: Escherichia coli [TaxId:562]
    Gene: yrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2r8yi_
  • Chain 'J':
    Compound: YrbI from Escherichia coli
    Species: Escherichia coli [TaxId:562]
    Gene: yrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2r8yj_
  • Chain 'K':
    Compound: YrbI from Escherichia coli
    Species: Escherichia coli [TaxId:562]
    Gene: yrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2r8yk_
  • Chain 'L':
    Compound: YrbI from Escherichia coli
    Species: Escherichia coli [TaxId:562]
    Gene: yrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2r8yl_
  • Chain 'M':
    Compound: YrbI from Escherichia coli
    Species: Escherichia coli [TaxId:562]
    Gene: yrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2r8ym_
  • Chain 'N':
    Compound: YrbI from Escherichia coli
    Species: Escherichia coli [TaxId:562]
    Gene: yrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2r8yn_
  • Chain 'O':
    Compound: YrbI from Escherichia coli
    Species: Escherichia coli [TaxId:562]
    Gene: yrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2r8yo_
  • Chain 'P':
    Compound: YrbI from Escherichia coli
    Species: Escherichia coli [TaxId:562]
    Gene: yrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2r8yp_
  • Heterogens: CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r8yA (A:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    deakgqsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r8yA (A:)
    latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
    sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
    idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakgqs
    i
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2r8yB (B:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    deakgqsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r8yB (B:)
    latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
    sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
    idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakgqs
    i
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2r8yC (C:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    deakgqsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r8yC (C:)
    latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
    sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
    idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakgqs
    i
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2r8yD (D:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    deakgqsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r8yD (D:)
    latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
    sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
    idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakgqs
    i
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2r8yE (E:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    deakgqsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r8yE (E:)
    latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
    sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
    idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakgqs
    i
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2r8yF (F:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    deakgqsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r8yF (F:)
    latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
    sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
    idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2r8yG (G:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    deakgqsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r8yG (G:)
    latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
    sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
    idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakgqs
    i
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2r8yH (H:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    deakgqsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r8yH (H:)
    latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
    sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
    idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakgqs
    i
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2r8yI (I:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    deakgqsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r8yI (I:)
    latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
    sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
    idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakgqs
    i
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2r8yJ (J:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    deakgqsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r8yJ (J:)
    latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
    sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
    idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakgqs
    i
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2r8yK (K:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    deakgqsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r8yK (K:)
    latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
    sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
    idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakgqs
    i
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2r8yL (L:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    deakgqsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r8yL (L:)
    latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
    sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
    idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakgqs
    i
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2r8yM (M:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    deakgqsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r8yM (M:)
    latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
    sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
    idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakgqs
    i
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2r8yN (N:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    deakgqsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r8yN (N:)
    latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
    sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
    idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakgqs
    i
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2r8yO (O:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    deakgqsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r8yO (O:)
    latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
    sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
    idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakgqs
    i
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2r8yP (P:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    deakgqsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r8yP (P:)
    latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
    sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
    idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakgqs
    i