PDB entry 2r8x

View 2r8x on RCSB PDB site
Description: Crystal structure of YrbI phosphatase from Escherichia coli
Class: hydrolase
Keywords: YrbI, phosphatase KDO8-P, HYDROLASE
Deposited on 2007-09-11, released 2008-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.203
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: yrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2r8xa_
  • Chain 'B':
    Compound: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: yrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2r8xb_
  • Chain 'C':
    Compound: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: yrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2r8xc_
  • Chain 'D':
    Compound: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: yrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2r8xd_
  • Chain 'E':
    Compound: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: yrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2r8xe_
  • Chain 'F':
    Compound: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: yrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2r8xf_
  • Chain 'G':
    Compound: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: yrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2r8xg_
  • Chain 'H':
    Compound: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: yrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2r8xh_
  • Chain 'I':
    Compound: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: yrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2r8xi_
  • Chain 'J':
    Compound: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: yrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2r8xj_
  • Chain 'K':
    Compound: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: yrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2r8xk_
  • Chain 'L':
    Compound: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: yrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2r8xl_
  • Chain 'M':
    Compound: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: yrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2r8xm_
  • Chain 'N':
    Compound: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: yrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2r8xn_
  • Chain 'O':
    Compound: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: yrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2r8xo_
  • Chain 'P':
    Compound: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: yrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2r8xp_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r8xA (A:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    deakgqsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r8xA (A:)
    latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
    sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
    idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakgqs
    i
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2r8xB (B:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    deakgqsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r8xB (B:)
    latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
    sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
    idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakgqs
    i
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2r8xC (C:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    deakgqsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r8xC (C:)
    latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
    sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
    idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakgqs
    i
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2r8xD (D:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    deakgqsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r8xD (D:)
    latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
    sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
    idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakgqs
    i
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2r8xE (E:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    deakgqsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r8xE (E:)
    latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
    sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
    idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakgqs
    i
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2r8xF (F:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    deakgqsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r8xF (F:)
    latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
    sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
    idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2r8xG (G:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    deakgqsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r8xG (G:)
    latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
    sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
    idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakgqs
    i
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2r8xH (H:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    deakgqsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r8xH (H:)
    aslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygirca
    ltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgd
    dlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakg
    qsi
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2r8xI (I:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    deakgqsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r8xI (I:)
    latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
    sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
    idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakgqs
    i
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2r8xJ (J:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    deakgqsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r8xJ (J:)
    latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
    sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
    idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakgqs
    i
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2r8xK (K:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    deakgqsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r8xK (K:)
    latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
    sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
    idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakgqs
    i
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2r8xL (L:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    deakgqsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r8xL (L:)
    latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
    sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
    idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakgqs
    i
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2r8xM (M:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    deakgqsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r8xM (M:)
    latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
    sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
    idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakgqs
    i
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2r8xN (N:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    deakgqsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r8xN (N:)
    latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
    sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
    idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakgqs
    i
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2r8xO (O:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    deakgqsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r8xO (O:)
    latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
    sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
    idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakgqs
    i
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2r8xP (P:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    deakgqsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r8xP (P:)
    latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
    sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
    idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakgqs
    i