PDB entry 2r8u

View 2r8u on RCSB PDB site
Description: Structure of fragment of human end-binding protein 1 (EB1) containing the N-terminal domain at 1.35 A resolution
Class: cell cycle
Keywords: cytoskeleton, Acetylation, Cell cycle, Cell division, Cytoplasm, Microtubule, Mitosis, Phosphorylation
Deposited on 2007-09-11, released 2008-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Microtubule-associated protein RP/EB family member 1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2r8ua_
  • Chain 'B':
    Compound: Microtubule-associated protein RP/EB family member 1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2r8ub1
  • Heterogens: MOO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r8uA (A:)
    mavnvystsvtsdnlsrhdmlawineslqlnltkieqlcsgaaycqfmdmlfpgsialkk
    vkfqakleheyiqnfkilqagfkrmgvdkiipvdklvkgkfqdnfefvqwfkkffdanyd
    gkdydpvaarqgqetavapslvapalnkpkkpltsssaapqrpistqrtaaapkagpgvv
    rknpgvgngddeaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlq
    rivdilyatdegfvipdeggpqeeqeey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r8uA (A:)
    mavnvystsvtsdnlsrhdmlawineslqlnltkieqlcsgaaycqfmdmlfpgsialkk
    vkfqakleheyiqnfkilqagfkrmgvdkiipvdklvkgkfqdnfefvqwfkkffdanyd
    gkdydpvaarq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2r8uB (B:)
    mavnvystsvtsdnlsrhdmlawineslqlnltkieqlcsgaaycqfmdmlfpgsialkk
    vkfqakleheyiqnfkilqagfkrmgvdkiipvdklvkgkfqdnfefvqwfkkffdanyd
    gkdydpvaarqgqetavapslvapalnkpkkpltsssaapqrpistqrtaaapkagpgvv
    rknpgvgngddeaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlq
    rivdilyatdegfvipdeggpqeeqeey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r8uB (B:)
    mavnvystsvtsdnlsrhdmlawineslqlnltkieqlcsgaaycqfmdmlfpgsialkk
    vkfqakleheyiqnfkilqagfkrmgvdkiipvdklvkgkfqdnfefvqwfkkffdanyd
    gkdydpvaarqggngd