PDB entry 2r8n

View 2r8n on RCSB PDB site
Description: Structural Analysis of the Unbound Form of HIV-1 Subtype C Protease
Class: hydrolase
Keywords: HIV-1 subtype C, Aspartyl protease, Hydrolase, Multifunctional enzyme, Nucleotidyltransferase, Protease, RNA-directed DNA polymerase, Transferase
Deposited on 2007-09-11, released 2008-07-29
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.141
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pol protein
    Species: Human immunodeficiency virus 1
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ALR4 (0-98)
      • engineered (6)
      • engineered (32)
      • see remark 999 (40)
      • engineered (62)
    Domains in SCOPe 2.02: d2r8na_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2r8nA (A:)
    pqitlwkrplvsikvggqikealldtgaddtvieeialpgrwkpkmiggiggfikvrqyd
    qiiieicgkkaigtvlvgptpvniigrnmltqlgctlnf