PDB entry 2r84

View 2r84 on RCSB PDB site
Description: Crystal structure of PurP from Pyrococcus furiosus complexed with AMP and AICAR
Class: Unknown Function
Keywords: ATP-grasp superfamily, Unknown Function
Deposited on 2007-09-10, released 2007-12-04
The last revision prior to the SCOP 1.75 freeze date was dated 2008-07-22, with a file datestamp of 2008-07-18.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.175
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PurP protein PF1517
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2r84a1, d2r84a2
  • Chain 'B':
    Compound: PurP protein PF1517
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2r84b1, d2r84b2
  • Heterogens: NA, CL, AMP, AMZ, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r84A (A:)
    mkvriatyashsalqilkgakdegfetiafgsskvkplytkyfpvadyfieekypeeell
    nlnavvvptgsfvahlgielvenmkvpyfgnkrvlrwesdrnlerkwlkkagirvpevye
    dpddiekpvivkphgakggkgyflakdpedfwrkaekflgikrkedlkniqiqeyvlgvp
    vyphyfyskvreelelmsidrryesnvdaigripakdqlefdmditytvignipivlres
    llmdvieagervvkaaeelmgglwgpfclegvftpdlefvvfeisarivagtnifvngsp
    ytwlrydrpvstgrriameireaiendmlekvlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r84A (A:)
    mkvriatyashsalqilkgakdegfetiafgsskvkplytkyfpvadyfieekypeeell
    nlnavvvptgsfvahlgielvenmkvpyfgnkrvlrwesdrnlerkwlkkagirvpevye
    dpddiekpvivkpgkgyflakdpedfwrkaekflgikrkedlkniqiqeyvlgvpvyphy
    fyskvreelelmsidrryesnvdaigripakdqlefdmditytvignipivlresllmdv
    ieagervvkaaeelmgglwgpfclegvftpdlefvvfeisarivagtnifvngspytwlr
    ydrpvstgrriameireaiendmlekvlt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2r84B (B:)
    mkvriatyashsalqilkgakdegfetiafgsskvkplytkyfpvadyfieekypeeell
    nlnavvvptgsfvahlgielvenmkvpyfgnkrvlrwesdrnlerkwlkkagirvpevye
    dpddiekpvivkphgakggkgyflakdpedfwrkaekflgikrkedlkniqiqeyvlgvp
    vyphyfyskvreelelmsidrryesnvdaigripakdqlefdmditytvignipivlres
    llmdvieagervvkaaeelmgglwgpfclegvftpdlefvvfeisarivagtnifvngsp
    ytwlrydrpvstgrriameireaiendmlekvlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r84B (B:)
    mkvriatyashsalqilkgakdegfetiafgsskvkplytkyfpvadyfieekypeeell
    nlnavvvptgsfvahlgielvenmkvpyfgnkrvlrwesdrnlerkwlkkagirvpevye
    dpddiekpvivkgyflakdpedfwrkaeiqiqeyvlgvpvyphyfyskvreelelmsidr
    ryesnvdaigripakdqlefdmditytvignipivlresllmdvieagervvkaaeelmg
    glwgpfclegvftpdlefvvfeisarivagtnifvngspytwlrydrpvstgrriameir
    eaiendmlekvlt