PDB entry 2r7z

View 2r7z on RCSB PDB site
Description: Cisplatin lesion containing RNA polymerase II elongation complex
Class: transcription/DNA-RNA hybrid
Keywords: transferase/DNA/RNA, DNA damage, zinc-finger, DNA-binding, phosphorylation, cisplatin lesion, misincorporation, RNA polymerase II, transcription- coupled repair, tcr, arrest, stalling, DNA lesion, metal-binding, nuclear protein, transcription bubble, damage recognition, elongation complex, transferase, transcription, transferase-DNA-RNA complex, transcription-DNA-RNA hybrid complex
Deposited on 2007-09-10, released 2007-11-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-09-05, with a file datestamp of 2012-08-31.
Experiment type: XRAY
Resolution: 3.8 Å
R-factor: 0.215
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-directed RNA polymerase II subunit RPB1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2r7za1
  • Chain 'B':
    Compound: DNA-directed RNA polymerase II subunit RPB2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2r7zb1
  • Chain 'C':
    Compound: DNA-directed RNA polymerase II subunit RPB3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: DNA-directed RNA polymerase II subunit RPB4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2r7zd1
  • Chain 'E':
    Compound: DNA-directed RNA polymerases I, II, and III subunit RPABC1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: DNA-directed RNA polymerases I, II, and III subunit RPABC2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2r7zf1
  • Chain 'G':
    Compound: DNA-directed RNA polymerase II subunit RPB7
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2r7zg1
  • Chain 'H':
    Compound: DNA-directed RNA polymerases I, II, and III subunit RPABC3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2r7zh1
  • Chain 'I':
    Compound: DNA-directed RNA polymerase II subunit RPB9
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: DNA-directed RNA polymerases I, II, and III subunit RPABC5
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2r7zj1
  • Chain 'K':
    Compound: DNA-directed RNA polymerase II subunit RPB11
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2r7zk1
  • Chain 'L':
    Compound: DNA-directed RNA polymerases I, II, and III subunit RPABC4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2r7zl1
  • Chain 'N':
    Compound: 5'-d(*cp*ap*ap*gp*tp*ap*g)-3'
    Species:
    Gene:
  • Chain 'P':
    Compound: 5'-r(*up*up*up*gp*ap*gp*gp*ap*gp*g)-3'
    Species:
    Gene:
  • Chain 'T':
    Compound: 5'-d(*tp*ap*cp*tp*tp*gup*cp*cp*cp*tp*cp*cp*tp*cp*ap*t)-3'
    Species:
    Gene:
  • Heterogens: CPT, ZN, MG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r7zA (A:)
    mvgqqyssaplrtvkevqfglfspeevraisvakirfpetmdetqtrakigglndprlgs
    idrnlkcqtcqegmnecpghfghidlakpvfhvgfiakikkvcecvcmhcgkllldehne
    lmrqalaikdskkrfaaiwtlcktkmvcetdvpseddptqlvsrggcgntqptirkdglk
    lvgswkkdratgdadepelrvlsteeilnifkhisvkdftslgfnevfsrpewmiltclp
    vppppvrpsisfnesqrgeddltfkladilkanisletlehngaphhaieeaesllqfhv
    atymdndiagqpqalqksgrpvksirarlkgkegrirgnlmgkrvdfsartvisgdpnle
    ldqvgvpksiaktltypevvtpynidrltqlvrngpnehpgakyvirdsgdridlryskr
    agdiqlqygwkverhimdndpvlfnrqpslhkmsmmahrvkvipystfrlnlsvtspyna
    dfdgdemnlhvpqseetraelsqlcavplqivspqsnkpcmgivqdtlcgirkltlrdtf
    ieldqvlnmlywvpdwdgviptpaiikpkplwsgkqilsvaipngihlqrfdegttllsp
    kdngmliidgqiifgvvekktvgssngglihvvtrekgpqvcaklfgniqkvvnfwllhn
    gfstgigdtiadgptmreitetiaeakkkvldvtkeaqanlltakhgmtlresfednvvr
    flneardkagrlaevnlkdlnnvkqmvmagskgsfiniaqmsacvgqqsvegkriafgfv
    drtlphfskddyspeskgfvensylrgltpqefffhamggreglidtavktaetgyiqrr
    lvkaledimvhydnttrnslgnviqfiygedgmdaahiekqsldtiggsdaafekryrvd
    llntdhtldpsllesgseilgdlklqvlldeeykqlvkdrkflrevfvdgeanwplpvni
    rriiqnaqqtfhidhtkpsdltikdivlgvkdlqenllvlrgkneiiqnaqrdavtlfcc
    llrsrlatrrvlqeyrltkqafdwvlsnieaqflrsvvhpgemvgvlaaqsigepatqmt
    lntfhfagvaskkvtsgvprlkeilnvaknmktpsltvylepghaadqeqaklirsaieh
    ttlksvtiaseiyydpdprstvipedeeiiqlhfslldeeaeqsfdqqspwllrleldra
    amndkdltmgqvgerikqtfkndlfviwsedndekliircrvvrpksldaeteaeedhml
    kkientmlenitlrgveniervvmmkydrkvpsptgeyvkepewvletdgvnlsevmtvp
    gidptriytnsfidimevlgieagraalykevynviasdgsyvnyrhmallvdvmttqgg
    ltsvtrhgfnrsntgalmrcsfeetveilfeagasaelddcrgvsenvilgqmapigtga
    fdvmideeslvkympeqkiteiedgqdggvtpysnesglvnadldvkdelmfsplvdsgs
    ndamaggftayggadygeatspfgaygeaptspgfgvsspgfsptsptysptspayspts
    psysptspsysptspsysptspsysptspsysptspsysptspsysptspsysptspsys
    ptspsysptspsysptspsysptspsysptspsysptspaysptspsysptspsysptsp
    sysptspsysptspnysptspsysptspgyspgspayspkqdeqkhnenensr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r7zA (A:)
    vgqqyssaplrtvkevqfglfspeevraisvakirfpetmdetqtrakigglndprlgsi
    drnlkcqtcqegmnecpghfghidlakpvfhvgfiakikkvcecvcmhcgkllldehnel
    mrqalaikdskkrfaaiwtlcktkmvcetdvpseddptqlvsrggcgntqptirkdglkl
    vgswkdepelrvlsteeilnifkhisvkdftslgfnevfsrpewmiltclpvppppvrps
    isfnesqrgeddltfkladilkanisletlehngaphhaieeaesllqfhvatymdndia
    gqpqalqksgrpvksirarlkgkegrirgnlmgkrvdfsartvisgdpnleldqvgvpks
    iaktltypevvtpynidrltqlvrngpnehpgakyvirdsgdridlryskragdiqlqyg
    wkverhimdndpvlfnrqpslhkmsmmahrvkvipystfrlnlsvtspynadfdgdemnl
    hvpqseetraelsqlcavplqivspqsnkpcmgivqdtlcgirkltlrdtfieldqvlnm
    lywvpdwdgviptpaiikpkplwsgkqilsvaipngihlqrfdegttllspkdngmliid
    gqiifgvvekktvgssngglihvvtrekgpqvcaklfgniqkvvnfwllhngfstgigdt
    iadgptmreitetiaeakkkvldvtkeaqanlltakhgmtlresfednvvrflneardka
    grlaevnlkdlnnvkqmvmagskgsfiniaqmsacvgqqsvegkriafgfvdrtlphfsk
    ddyspeskgfvensylrgltpqefffhamggreglidtavktaetgyiqrrlvkaledim
    vhydnttrnslgnviqfiygedgmdaahiekqsldtiggsdaafekryrvdllntdhtld
    psllesgseilgdlklqvlldeeykqlvkdrkflrevfvdgeanwplpvnirriiqnaqq
    tfhidhtkpsdltikdivlgvkdlqenllvlrgkneiiqnaqrdavtlfccllrsrlatr
    rvlqeyrltkqafdwvlsnieaqflrsvvhpgemvgvlaaqsigepatqmtlkkvtsgvp
    rlkeilnvaknmktpsltvylepghaadqeqaklirsaiehttlksvtiaseiyydpdpr
    stvipedeeiiqlhfslqqspwllrleldraamndkdltmgqvgerikqtfkndlfviws
    edndekliircrvvaeedhmlkkientmlenitlrgveniervvmmkydrkvpsptgeyv
    kepewvletdgvnlsevmtvpgidptriytnsfidimevlgieagraalykevynviasd
    gsyvnyrhmallvdvmttqggltsvtrhgfnrsntgalmrcsfeetveilfeagasaeld
    dcrgvsenvilgqmapigtgafdvmideeslvkymp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2r7zB (B:)
    msdlansekyydedpygfedesapitaedswavisaffrekglvsqqldsfnqfvdytlq
    diicedstlileqlaqhttesdnisrkyeisfgkiyvtkpmvnesdgvthalypqearlr
    nltyssglfvdvkkrtyeaidvpgrelkyeliaeeseddsesgkvfigrlpimlrskncy
    lseatesdlyklkecpfdmggyfiingsekvliaqersagnivqvfkkaapspishvaei
    rsalekgsrfistlqvklygregssartikatlpyikqdipiviifralgiipdgeileh
    icydvndwqmlemlkpcvedgfviqdretaldfigrrgtalgikkekriqyakdilqkef
    lphitqlegfesrkafflgyminrlllcaldrkdqddrdhfgkkrldlagpllaqlfktl
    fkkltkdifrymqrtveeahdfnmklainaktitsglkyalatgnwgeqkkamssragvs
    qvlnrytysstlshlrrtntpigrdgklakprqlhnthwglvcpaetpegqacglvknls
    lmscisvgtdpmpiitflsewgmepledyvphqspdatrvfvngvwhgvhrnparlmetl
    rtlrrkgdinpevsmirdirekelkiftdagrvyrplfiveddeslghkelkvrkghiak
    lmateyqdieggfedveeytwssllneglveyidaeeeesiliamqpedlepaeaneend
    ldvdpakrirvshhattfthceihpsmilgvaasiipfpdhnqsprntyqsamgkqamgv
    fltnynvrmdtmanilyypqkplgttrameylkfrelpagqnaivaiacysgynqedsmi
    mnqssidrglfrslffrsymdqekkygmsitetfekpqrtntlrmkhgtydkldddglia
    pgvrvsgedviigkttpispdeeelgqrtayhskrdastplrstengivdqvlvttnqdg
    lkfvkvrvrttkipqigdkfasrhgqkgtigityrredmpftaegivpdliinphaipsr
    mtvahliecllskvaalsgnegdaspftditvegiskllrehgyqsrgfevmynghtgkk
    lmaqiffgptyyqrlrhmvddkiharargpmqvltrqpvegrsrdgglrfgemerdcmia
    hgaasflkerlmeasdafrvhicgicglmtviaklnhnqfeckgcdnkidiyqihipyaa
    kllfqelmamnitprlytdrsrdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r7zB (B:)
    desapitaedswavisaffrekglvsqqldsfnqfvdytlqdiicedstliisfgkiyvt
    kpmvnesdgvthalypqearlrnltyssglfvdvkkkvfigrlpimlrskncylseates
    dlyklkecpfdmggyfiingsekvliaqersagnivqvfkkaapspishvaeirsalekg
    srfistlqvklygregssartikatlpyikqdipiviifralgiipdgeilehicydvnd
    wqmlemlkpcvedgfviqdretaldfigkekriqyakdilqkeflphitqlegfesrkaf
    flgyminrlllcaldrkdqddrdhfgkkrldlagpllaqlfktlfkkltkdifrymqrtv
    elainaktitsglkyalatgnwgeqkkamssragvsqvlnrytysstlshlrrtntpikl
    akprqlhnthwglvcpaetpegqacglvknlslmscisvgtdpmpiitflsewgmepled
    yvphqspdatrvfvngvwhgvhrnparlmetlrtlrrkgdinpevsmirdirekelkift
    dagrvyrplfiveddeslghkelkvrkghiaklmateyqdeytwssllneglveyidaee
    eesiliamqpedlepaeadvdpakrirvshhattfthceihpsmilgvaasiipfpdhnq
    sprntyqsamgkqamgvfltnynvrmdtmanilyypqkplgttrameylkfrelpagqna
    ivaiacysgynqedsmimnqssidrglfrslffrsymdqekkygmsitetfekpqrtntl
    rmkhgtydkldddgliapgvrvsgedviigkttpisskrdastplrstengivdqvlvtt
    nqdglkfvkvrvrttkipqigdkfasrhgqkgtigityrredmpftaegivpdliinpha
    ipsrmtvahliecllskvaalsgnegdaspftditvegiskllrehgyqsrgfevmyngh
    tgkklmaqiffgptyyqrlrhmvddkiharargpmqvltrqpvegrsrdgglrfgemerd
    cmiahgaasflkerlmeasdafrvhicgicglmtviaklnhnqfeckgcdnkidiyqihi
    pyaakllfqelmamnitprlytdrsrdf
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2r7zD (D:)
    mnvststfqtrrrrlkkveeeenaatlqlgqefqlkqinhqgeeeelialnlsearlvik
    ealverrrafkrsqkkhkkkhlkhenandettavededddldeddvnaddddfmhsetre
    kelesidvlleqttggnnkdlkntmqyltnfsrfrdqetvgaviqllkstglhpfevaql
    gslacdtadeaktlipslnnkisddelerilkelsnletly
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r7zD (D:)
    ststfqtrrrrlkkveeeenaatlqlgqefqlkqinhqgeeeelialnlsearlvikeal
    verrrafkrsqkktrekelesidvlleqttggnnkdlkntmqyltnfsrfrdqetvgavi
    qllkstglhpfevaqlgslacdtadeaktlipslnnkisddelerilkelsnletly
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2r7zF (F:)
    msdyeeafndgnenfedfdvehfsdeetyeekpqfkdgettdangktivtggngpedfqq
    heqirrktlkekaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplri
    amkelaekkiplvirrylpdgsfedwsveelivdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r7zF (F:)
    kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
    lvirrylpdgsfedwsveelivdl
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2r7zG (G:)
    mffikdlslnitlhpsffgprmkqylktklleevegsctgkfgyilcvldydnidiqrgr
    ilptdgsaefnvkyravvfkpfkgevvdgtvvscsqhgfevqvgpmkvfvtkhlmpqdlt
    fnagsnppsyqssedvitiksrirvkiegcisqvssihaigsikedylgai
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2r7zH (H:)
    msntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtia
    sslnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfgg
    llmrlegnyrnlnnlkqenayllirr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r7zH (H:)
    sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
    sltrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggllmrlegnyrnln
    nlkqenayllirr
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2r7zJ (J:)
    mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
    lrynplekrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r7zJ (J:)
    mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
    lrynp
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2r7zK (K:)
    mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa
    ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtlaaddaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r7zK (K:)
    mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa
    ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2r7zL (L:)
    msregfqiptnldaaaagtsqartatlkyicaecssklslsrtdavrckdcghrillkar
    tkrlvqfear
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r7zL (L:)
    atlkyicaecssklslsrtdavrckdcghrillkartkrlvqfear
    

  • Chain 'N':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.