PDB entry 2r7y

View 2r7y on RCSB PDB site
Description: Selenium Derivatized RNA/DNA Hybrid in complex with RNase H CATALYTIC DOMAIN MUTANT D132N
Class: Hydrolase/RNA/DNA
Keywords: Selenium-DNA/RNA, RNASE H, RIBONUCLEASE H RNA/DNA Complex, Cytoplasm, Endonuclease, Hydrolase, Magnesium, Manganese, Metal-binding, Hydrolase/RNA/DNA COMPLEX
Deposited on 2007-09-10, released 2008-05-06
The last revision prior to the SCOP 1.75 freeze date was dated 2008-05-06, with a file datestamp of 2008-05-02.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.185
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease H
    Species: Bacillus halodurans
    Gene: rnhA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KEI9 (0-131)
      • engineered (70)
    Domains in SCOP 1.75: d2r7ya1
  • Chain 'B':
    Compound: RNA (5'-r(*up*cp*gp*ap*cp*a)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*dap*dtp*(sdg)p*dtp*dcp*(sdg))-3')
  • Heterogens: MG, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2r7yA (A:)
    eiiweslsvdvgsqgnpgiveykgvdtktgevlferepipigtnnmgeflaivhglrylk
    ernsrkpiysnsqtaikwvkdkkakstlvrneetaliwklvdeaeewlnthtyetpilkw
    qtdkwgeikady
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.