PDB entry 2r7u

View 2r7u on RCSB PDB site
Description: crystal structure of rotavirus sa11 vp1/rna (aaaagcc) complex
Deposited on 2007-09-10, released 2008-07-29
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-dependent RNA polymerase
    Species: Simian rotavirus [TaxId:10922]
    Gene: gene 1
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: RNA (5'-r(*ap*a*ap*ap*gp*cp*c)-3')

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2r7uA (A:)
    mgkynlilseylsfiynsqsavqipiyyssnselenrciefhskclensknglslrklfv
    eyndvienatllsilsysydkynaverklvkyakgkpleadltvneldyennkmtselfp
    taeeytdslmdpailtslssnlnavmfwlekhendvaeklkvykrrldlftivastinky
    gvprhnakyryeydvmkdkpyylvtwanssiemlmsvfshddyliakelivlsysnrstl
    aklvsspmsilvalvdingtfitneelelefsnkyvraivpdqtfdelnqmldnmrkagl
    vdipkmiqdwlvdrsiekfplmakiyswsfhvgfrkqkmldaaldqlkteytenvddemy
    reytmlirdevvkmleepvkhddhllrdselagllsmssasngesrqlkfgrktifstkk
    nmhvmddmanerytpgiippvnvdkpiplgrrdvpgrrtriifilpyeyfiaqhavvekm
    liyakhtreyaefysqsnqllsygdvtrflsnntmvlytdvsqwdssqhntqpfrkgiim
    gldilanmtndakvlqtlnlykqtqinlmdsyvqipdgnvikkiqygavasgekqtkaan
    sianlaliktvlsrisnkhsfatkiirvdgddnyavlqfntevtkqmiqdvsndvretya
    rmnakvkalvstvgieiakryiaggkiffraginllnnekrgqstqwdqaailysnyivn
    rlrgfetdrefiltkimqmtsvaitgslrlfpservlttnstfkvfdsedfiieygttvd
    evyiqrafmslssqksgiadeiaasstfknyvtrlseqllfsknnivsrgialtekakln
    syapislekrraqisalltmlqkpvtfksskitindilrdikpfftvsdahlpiqyqkfm
    ptlpdnvqyiiqcigsrtyqieddgsksaisrliskysvykpsieelykvislheneiql
    ylislgipkidadtyvgskiysrdkyrilesyvynllsinygcyqlfdfnspdlekliri
    pfkgkipavtfilhlyaklevinyaikngswislfcnypksemiklwkkmwnitslrspy
    tnanffqephhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >2r7uA (A:)
    gkynlilseylsfiynsvqipiyyssnselenrciefhskclensknglslrklfveynd
    vienatllsilsysydkynaverklvkyakgkpleadltvneldyennkmtselfptaee
    ytdslmdpailtslssnlnavmfwlekhendvaeklkvykrrldlftivastinkygvpr
    hnakyryeydvmkdkpyylvtwanssiemlmsvfshddyliakelivlsysnrstlaklv
    sspmsilvalvdingtfitneelelefsnkyvraivpdqtfdelnqmldnmrkaglvdip
    kmiqdwlvdrsiekfplmakiyswsfhvgfrkqkmldaaldqemyreytmlirdevvkml
    eepvkhddhllrdselagllsmssasngesrqlkfgrktifstkknmhvmddmanerytp
    giippvnvdkpiplgrrdvpgrrtriifilpyeyfiaqhavvekmliyakhtreyaefys
    qsnqllsygdvtrflsnntmvlytdvsqwdssqhntqpfrkgiimgldilanmtndakvl
    qtlnlykqtqinlmdsyvqipdgnvikkiqygavasgekqtkaansianlaliktvlsri
    snkhsfatkiirvdgddnyavlqfntevtkqmiqdvsndvretyarmnakvkalvstvgi
    eiakryiaggkiffraginllnnekrgqstqwdqaailysnyivnrlrgfetdrefiltk
    imqmtsvaitgslrlfpservlttnstfkvfdsedfiieygttvdevyiqrafmslssqk
    sgiadeiaasstfknyvtrlseqllfsknnivsrgialtekaklnsyapislekrraqis
    alltmlqkpvtfksskitindilrdikpfftvsdahlpiqyqkfmptlpdnvqyiiqcig
    srtyqieddgsksaisrliskysvykpsieelykvislheneiqlylislgipkidadty
    vgskiysrdkyrilesyvynllsinygcyqlfdfnspdlekliripfkgkipavtfilhl
    yaklevinyaikngswislfcnypksemiklwkkmwnitslrspytnanffqe
    

  • Chain 'X':
    No sequence available.