PDB entry 2r75

View 2r75 on RCSB PDB site
Description: Aquifex aeolicus FtsZ with 8-morpholino-GTP
Class: cell cycle
Keywords: GTPase, tubulin-like, inhibitor, CELL CYCLE
Deposited on 2007-09-07, released 2008-07-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.139
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: cell division protein ftsz
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: ftsZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2r7511, d2r7512
  • Heterogens: MG, 01G, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >2r751 (1:)
    meefvnpckikvigvggggsnavnrmyedgiegvelyaintdvqhlstlkvpnkiqigek
    vtrglgagakpevgeeaaledidkikeilrdtdmvfisaglgggtgtgaapviaktakem
    giltvavatlpfrfegprkmekalkgleklkessdayivihndkikelsnrtltikdafk
    evdsvlskavrgitsivvtpavinvdfadvrttleegglsiigmgegrgdekadiaveka
    vtspllegntiegarrllvtiwtsedipydivdevmerihskvhpeaeiifgavlepqeq
    dfirvaivatdfpeekfqvgekevkfkvikklhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r751 (1:)
    ckikvigvggggsnavnrmyedgiegvelyaintdvqhlstlkvpnkiqigekvtrglga
    gakpevgeeaaledidkikeilrdtdmvfisaglgggtgtgaapviaktakemgiltvav
    atlpfrfegprkmekalkgleklkessdayivihndkikelsnrtltikdafkevdsvls
    kavrgitsivvtpavinvdfadvrttleegglsiigmgegrgdekadiavekavtsplle
    gntiegarrllvtiwtsedipydivdevmerihskvhpeaeiifgavlepqeqdfirvai
    vatdfpeekfqvgekevkfkvik