PDB entry 2r73

View 2r73 on RCSB PDB site
Description: Crystal Structure of the Possum Milk Whey Lipocalin Trichosurin at pH 8.2
Class: transport protein
Keywords: lipocalin, beta barrel, milk whey lipocalin, dimer, Glycoprotein, Milk protein, Secreted, Transport, TRANSPORT PROTEIN
Deposited on 2007-09-07, released 2007-11-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.217
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trichosurin
    Species: Trichosurus vulpecula [TaxId:9337]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q29147 (Start-165)
      • engineered (101)
    Domains in SCOPe 2.08: d2r73a_
  • Chain 'B':
    Compound: Trichosurin
    Species: Trichosurus vulpecula [TaxId:9337]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q29147 (Start-165)
      • engineered (101)
    Domains in SCOPe 2.08: d2r73b_
  • Chain 'C':
    Compound: Trichosurin
    Species: Trichosurus vulpecula [TaxId:9337]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q29147 (Start-165)
      • engineered (101)
    Domains in SCOPe 2.08: d2r73c_
  • Chain 'D':
    Compound: Trichosurin
    Species: Trichosurus vulpecula [TaxId:9337]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q29147 (Start-165)
      • engineered (101)
    Domains in SCOPe 2.08: d2r73d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r73A (A:)
    mlqpecsrseedlsdekerkweqlsrhwhtvvlassdrslieeegpfrnfiqnitvesgn
    lngffltrkngqciplyltafkteearqfklnyygtndvyyesskpneyakfifynyhdg
    kvnvvanlfgrtpnlsneikkrfeedfmnrgfrrenildisevdhc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r73A (A:)
    weqlsrhwhtvvlassdrslieeegpfrnfiqnitvesgnlngffltrkngqciplylta
    fkteearqfklnyygtndvyyesskpneyakfifynyhdgkvnvvanlfgrtpnlsneik
    krfeedfmnrgfrrenildisevdhc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2r73B (B:)
    mlqpecsrseedlsdekerkweqlsrhwhtvvlassdrslieeegpfrnfiqnitvesgn
    lngffltrkngqciplyltafkteearqfklnyygtndvyyesskpneyakfifynyhdg
    kvnvvanlfgrtpnlsneikkrfeedfmnrgfrrenildisevdhc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r73B (B:)
    eqlsrhwhtvvlassdrslieeegpfrnfiqnitvesgnlngffltrkngqciplyltaf
    kteearqfklnyygtndvyyesskpneyakfifynyhdgkvnvvanlfgrtpnlsneikk
    rfeedfmnrgfrrenildisevdhc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2r73C (C:)
    mlqpecsrseedlsdekerkweqlsrhwhtvvlassdrslieeegpfrnfiqnitvesgn
    lngffltrkngqciplyltafkteearqfklnyygtndvyyesskpneyakfifynyhdg
    kvnvvanlfgrtpnlsneikkrfeedfmnrgfrrenildisevdhc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r73C (C:)
    weqlsrhwhtvvlassdrslieeegpfrnfiqnitvesgnlngffltrkngqciplylta
    fkteearqfklnyygtndvyyesskpneyakfifynyhdgkvnvvanlfgrtpnlsneik
    krfeedfmnrgfrrenildisevdhc
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2r73D (D:)
    mlqpecsrseedlsdekerkweqlsrhwhtvvlassdrslieeegpfrnfiqnitvesgn
    lngffltrkngqciplyltafkteearqfklnyygtndvyyesskpneyakfifynyhdg
    kvnvvanlfgrtpnlsneikkrfeedfmnrgfrrenildisevdhc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r73D (D:)
    weqlsrhwhtvvlassdrslieeegpfrnfiqnitvesgnlngffltrkngqciplylta
    fkteearqfklnyygtndvyyesskpneyakfifynyhdgkvnvvanlfgrtpnlsneik
    krfeedfmnrgfrrenildisevdhc