PDB entry 2r6x

View 2r6x on RCSB PDB site
Description: Structure of a D35N variant PduO-type ATP:co(I)rrinoid adenosyltransferase from Lactobacillus reuteri complexed with ATP
Class: transferase
Keywords: adenosyltransferase variant, ATP binding
Deposited on 2007-09-06, released 2007-12-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: 0.177
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cobalamin adenosyltransferase PduO-like protein
    Species: Lactobacillus reuteri [TaxId:1598]
    Gene: COBA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q50EJ2 (7-End)
      • engineered (40)
    Domains in SCOPe 2.08: d2r6xa_
  • Chain 'B':
    Compound: Cobalamin adenosyltransferase PduO-like protein
    Species: Lactobacillus reuteri [TaxId:1598]
    Gene: COBA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q50EJ2
      • engineered (40)
    Domains in SCOPe 2.08: d2r6xb_
  • Heterogens: MG, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r6xA (A:)
    gasapmvkiytkngdkgqtriigkqilykndprvaaygevnelnswvgytkslinshtqv
    lsneleeiqqllfdcghdlatpadderhsfkfkqeqptvwleekidnytqvvpavkkfil
    pggtqlasalhvartitrraerqivqlmreeqinqdvlifinrlsdyffaaaryanyleq
    qpdmlyrnskdvfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r6xA (A:)
    kiytkngdkgqtriigkqilykndprvaaygevnelnswvgytkslinshtqvlsnelee
    iqqllfdcghdlatpadderhfkfkqeqptvwleekidnytqvvpkfilpggtqlasalh
    vartitrraerqivqlmreeqinqdvlifinrlsdyffaaaryanyleqqpdmlyr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2r6xB (B:)
    gasapmvkiytkngdkgqtriigkqilykndprvaaygevnelnswvgytkslinshtqv
    lsneleeiqqllfdcghdlatpadderhsfkfkqeqptvwleekidnytqvvpavkkfil
    pggtqlasalhvartitrraerqivqlmreeqinqdvlifinrlsdyffaaaryanyleq
    qpdmlyrnskdvfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r6xB (B:)
    iytkngdkgqtriiqilykndprvaaygevnelnswvgytkslinshtqvlsneleeiqq
    llfdcghdlatprhsfkfkqeqptvwleekidnytqvvpavkkfilpggtqlasalhvar
    titrraerqivqlmreeqinqdvlifinrlsdyffaaaryanyleqqpdmlyr