PDB entry 2r6u

View 2r6u on RCSB PDB site
Description: Crystal structure of gene product RHA04853 from Rhodococcus sp. RHA1
Deposited on 2007-09-06, released 2007-09-25
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.178
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Rhodococcus sp. [TaxId:101510]
    Gene: RHA04853, RHA1_ro04536
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0S814 (21-145)
      • expression tag (16-20)
  • Chain 'B':
    Compound: Uncharacterized protein
    Species: Rhodococcus sp. [TaxId:101510]
    Gene: RHA04853, RHA1_ro04536
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Uncharacterized protein
    Species: Rhodococcus sp. [TaxId:101510]
    Gene: RHA04853, RHA1_ro04536
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0S814 (21-End)
      • expression tag (19-20)
  • Chain 'D':
    Compound: Uncharacterized protein
    Species: Rhodococcus sp. [TaxId:101510]
    Gene: RHA04853, RHA1_ro04536
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0S814 (21-145)
      • expression tag (15-20)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2r6uA (A:)
    mgsshhhhhhssgrenlyfqgmtgrivhfeipfddgdrarafyrdafgwaiaeipdmdys
    mvttgpvgesgmpdepgyinggmmqrgevttpvvtvdvesiesalerieslggktvtgrt
    pvgnmgfaayftdsegnvvglwetargs
    

    Sequence, based on observed residues (ATOM records):
    >2r6uA (A:)
    lyfqgmtgrivhfeipfddgdrarafyrdafgwaiaeipdmdysmvttgpvgesgmpdep
    gyinggmmqrgevttpvvtvdvesiesalerieslggktvtgrtpvgnmgfaayftdseg
    nvvglwetar
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >2r6uB (B:)
    mgsshhhhhhssgrenlyfqgmtgrivhfeipfddgdrarafyrdafgwaiaeipdmdys
    mvttgpvgesgmpdepgyinggmmqrgevttpvvtvdvesiesalerieslggktvtgrt
    pvgnmgfaayftdsegnvvglwetargs
    

    Sequence, based on observed residues (ATOM records):
    >2r6uB (B:)
    mtgrivhfeipfddgdrarafyrdafgwaiaeimdysmvttgpvgesgmpdepgyinggm
    mqrgevttpvvtvdvesiesalerieslggktvtgrtpvgnmgfaayftdsegnvvglwe
    tar
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >2r6uC (C:)
    mgsshhhhhhssgrenlyfqgmtgrivhfeipfddgdrarafyrdafgwaiaeipdmdys
    mvttgpvgesgmpdepgyinggmmqrgevttpvvtvdvesiesalerieslggktvtgrt
    pvgnmgfaayftdsegnvvglwetargs
    

    Sequence, based on observed residues (ATOM records):
    >2r6uC (C:)
    qgmtgrivhfeipfddgdrarafyrdafgwaiaeipdmdysmvttgpvgesgmpdepgyi
    nggmmqrgevttpvvtvdvesiesalerieslggktvtgrtpvgnmgfaayftdsegnvv
    glweta
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >2r6uD (D:)
    mgsshhhhhhssgrenlyfqgmtgrivhfeipfddgdrarafyrdafgwaiaeipdmdys
    mvttgpvgesgmpdepgyinggmmqrgevttpvvtvdvesiesalerieslggktvtgrt
    pvgnmgfaayftdsegnvvglwetargs
    

    Sequence, based on observed residues (ATOM records):
    >2r6uD (D:)
    nlyfqgmtgrivhfeipfddgdrarafyrdafgwaiaeipdmdysmvttgpvgesgmpde
    pgyinggmmqrgevttpvvtvdvesiesalerieslggktvtgrtpvgnmgfaayftdse
    gnvvglwetar