PDB entry 2r6r

View 2r6r on RCSB PDB site
Description: Aquifex aeolicus FtsZ
Class: cell cycle
Keywords: FtsZ, GTPase, tubulin-like, Cell cycle, Cell division, GTP-binding, Nucleotide-binding, Septation
Deposited on 2007-09-06, released 2007-10-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.181
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: cell division protein ftsz
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: ftsZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2r6r11, d2r6r12
  • Heterogens: GDP, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >2r6r1 (1:)
    meefvnpckikvigvggggsnavnrmyedgiegvelyaintdvqhlstlkvpnkiqigek
    vtrglgagakpevgeeaaledidkikeilrdtdmvfisaglgggtgtgaapviaktakem
    giltvavatlpfrfegprkmekalkgleklkessdayivihndkikelsnrtltikdafk
    evdsvlskavrgitsivvtpavinvdfadvrttleegglsiigmgegrgdekadiaveka
    vtspllegntiegarrllvtiwtsedipydivdevmerihskvhpeaeiifgavlepqeq
    dfirvaivatdfpeekfqvgekevkfkvikklhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r6r1 (1:)
    ckikvigvggggsnavnrmyedgiegvelyaintdvqhlstlkvpnkiqigekvtrglga
    gakpevgeeaaledidkikeilrdtdmvfisaglgggtgtgaapviaktakemgiltvav
    atlpfrfegprkmekalkgleklkessdayivihndkikelsnrtltikdafkevdsvls
    kavrgitsivvtpavinvdfadvrttleegglsiigmgegrgdekadiavekavtsplle
    gntiegarrllvtiwtsedipydivdevmerihskvhpeaeiifgavlepqeqdfirvai
    vatdfpeekfqvgekevkfkvik