PDB entry 2r6n

View 2r6n on RCSB PDB site
Description: Crystal structure of a pyrrolopyrimidine inhibitor in complex with human Cathepsin K
Class: hydrolase
Keywords: covalent bond to inhibitor, Disease mutation, Glycoprotein, Hydrolase, Lysosome, Protease, Thiol protease, Zymogen
Deposited on 2007-09-06, released 2007-11-06
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.156
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cathepsin k
    Species: Homo sapiens [TaxId:9606]
    Gene: CTSK, CTSO, CTSO2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2r6na1
  • Heterogens: CKE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r6nA (A:)
    grapdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvs
    endgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegne
    kalkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhw
    iiknswgenwgnkgyilmarnknnacgianlasfpkm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r6nA (A:)
    rapdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvse
    ndgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegnek
    alkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwi
    iknswgenwgnkgyilmarnknnacgianlasfpkm