PDB entry 2r6i

View 2r6i on RCSB PDB site
Description: Crystal structure of Atu1473 protein, a putative chaperone from Agrobacterium tumefaciens
Class: chaperone
Keywords: chaperone, structural genomics, APC6123, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2007-09-05, released 2007-09-18
The last revision prior to the SCOP 1.75 freeze date was dated 2007-09-18, with a file datestamp of 2007-09-14.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: 0.242
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein Atu1473
    Species: Agrobacterium tumefaciens str. C58
    Gene: Atu1473, AGR_C_2717
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UFC5 (21-281)
      • expression tag (14-20)
    Domains in SCOP 1.75: d2r6ia1
  • Chain 'B':
    Compound: Uncharacterized protein Atu1473
    Species: Agrobacterium tumefaciens str. C58
    Gene: Atu1473, AGR_C_2717
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UFC5 (21-281)
      • expression tag (14-20)
    Domains in SCOP 1.75: d2r6ib1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r6iA (A:)
    mgsshhhhhhssgrenlyfqgmrdllndlseglshpdpilraqiqmqkplpkrfykdvtv
    adveeggftilldgkplrtpakkplvapsraladllrdewdaqkevvnpvvmpvsrhvnt
    aidgiasdtqavfedilrfsssdllcyragdpealvarqtdywdpvldwatnvlgarfil
    vegvmhrdqpreaiaafavtlkkydtpialaalhtmtsltgsailalalaegeltleeaw
    alahldedwtaeqwgedeealerravrlidmraalnvleslkgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r6iA (A:)
    enlyfqgmrdllndlseglshpdpilraqiqmqkplpkrfykdvtvadveeggftilldg
    kplrtpakkplvapsraladllrdewdaqkevvnpvvmpvsrhvntaidgiasdtqavfe
    dilrfsssdllcyragdpealvarqtdywdpvldwatnvlgarfilvegvmhrdqpreai
    aafavtlkkydtpialaalhtmtsltgsailalalaegeltleeawalahldedwtaeqw
    gedeealerravrlidmraalnvleslk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2r6iB (B:)
    mgsshhhhhhssgrenlyfqgmrdllndlseglshpdpilraqiqmqkplpkrfykdvtv
    adveeggftilldgkplrtpakkplvapsraladllrdewdaqkevvnpvvmpvsrhvnt
    aidgiasdtqavfedilrfsssdllcyragdpealvarqtdywdpvldwatnvlgarfil
    vegvmhrdqpreaiaafavtlkkydtpialaalhtmtsltgsailalalaegeltleeaw
    alahldedwtaeqwgedeealerravrlidmraalnvleslkgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r6iB (B:)
    enlyfqgmrdllndlseglshpdpilraqiqmqkplpkrfykdvtvadveeggftilldg
    kplrtpakkplvapsraladllrdewdaqkevvnpvvmpvsrhvntaidgiasdtqavfe
    dilrfsssdllcyragdpealvarqtdywdpvldwatnvlgarfilvegvmhrdqpreai
    aafavtlkkydtpialaalhtmtsltgsailalalaegeltleeawalahldedwtaeqw
    gedeealerravrlidmraalnvleslk