PDB entry 2r69

View 2r69 on RCSB PDB site
Description: Crystal structure of Fab 1A1D-2 complexed with E-DIII of Dengue virus at 3.8 angstrom resolution
Class: viral protein/Immune system
Keywords: Fab-antigen complex, Capsid protein, Cleavage on pair of basic residues, Core protein, Envelope protein, Glycoprotein, Membrane, Transmembrane, Virion, viral protein-Immune system COMPLEX
Deposited on 2007-09-05, released 2007-12-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 3.8 Å
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major envelope protein E
    Species: Dengue virus [TaxId:31634]
    Gene: E protein
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2r69a1
  • Chain 'H':
    Compound: Heavy chain of 1A1D-2
    Species: Mus musculus [TaxId:10090]
    Gene: immunoglobulin
    Database cross-references and differences (RAF-indexed):
    • PDB 2R69 (0-End)
  • Chain 'L':
    Compound: Light chain of 1A1D-2
    Species: Mus musculus [TaxId:10090]
    Gene: immunoglobulin
    Database cross-references and differences (RAF-indexed):
    • PDB 2R69 (0-End)
    Domains in SCOPe 2.07: d2r69l1, d2r69l2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2r69A (A:)
    sysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpi
    vtekdspvnieaeppfgdsyiiigvepgqlklnwfkk
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2r69L (L:)
    divltqspaslavslgqratiscrasesvvrygnsfmhwyqqkpgqppklliyrassles
    giptrfsgsgsrtdftltinpveaddvatyycqqtnvdpwafgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceatspivksfnrne
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r69L (L:)
    divltqspaslavslgqratiscrasesvvrygnsfmhwyqqkpgqppklliyrassles
    giptrfsgsgsrtdftltinpveaddvatyycqqtnvdpwafgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceatksf