PDB entry 2r63

View 2r63 on RCSB PDB site
Description: structural role of a buried salt bridge in the 434 repressor DNA-binding domain, nmr, 20 structures
Class: gene regulating protein
Keywords: gene regulating protein, phage 434 repressor, helix-turn-helix, DNA-binding domain
Deposited on 1996-11-13, released 1997-06-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: repressor protein from bacteriophage 434
  Species: Phage 434 [TaxId:10712]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P16117 (0-62)
    • engineered (9)
  Domains in SCOPe 2.08: d2r63a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2r63A (A:)
  sissrvkskmiqlglnqaelaqkvgttqqsieqlengktkrprflpelasalgvsvdwll
  ngt