PDB entry 2r5y

View 2r5y on RCSB PDB site
Description: Structure of Scr/Exd complex bound to a consensus Hox-Exd site
Class: transcription/DNA
Keywords: Homeodomain, homeotic proteins, specificity, Developmental protein, DNA-binding, Homeobox, Nucleus, Transcription, Transcription regulation, TRANSCRIPTION/DNA COMPLEX
Deposited on 2007-09-04, released 2008-02-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.255
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Homeotic protein Sex combs reduced
  Species: Drosophila melanogaster [TaxId:7227]
  Gene: Scr
  Database cross-references and differences (RAF-indexed):
  • Uniprot P09077 (1-87)
    • expression tag (0)
    • engineered (65)
  Domains in SCOPe 2.08: d2r5ya1, d2r5ya2
• Chain 'B':
  Compound: Homeobox protein extradenticle
  Species: Drosophila melanogaster [TaxId:7227]
  Gene: exd
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40427 (Start-62)
  Domains in SCOPe 2.08: d2r5yb_
• Chain 'C':
  Compound: DNA (5'-d(*dap*dcp*dtp*dcp*dtp*dap*dtp*dgp*dap*dtp*dtp*dtp*dap*dtp*dgp*dgp*dgp*dcp*dtp*dg)-3')
  
• Chain 'D':
  Compound: DNA (5'-d(*dtp*dcp*dap*dgp*dcp*dcp*dcp*dap*dtp*dap*dap*dap*dtp*dcp*dap*dtp*dap*dgp*dap*dg)-3')
  
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2r5yA (A:)
  gkknppqiypwmkrvhlgtstvnangetkrqrtsytryqtlelekefhfnryltrrrrie
  iahalslterqikiwfqnrrmkwkkehk
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2r5yA (A:)
  gkknppqiypwmkrvqrtsytryqtlelekefhfnryltrrrrieiahalslterqikiw
  fqnrrmkwkkehk
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >2r5yB (B:)
  arrkrrnfskqaseilneyfyshlsnpypseeakeelarkcgitvsqvsnwfgnkriryk
  kni
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2r5yB (B:)
  rrnfskqaseilneyfyshlsnpypseeakeelarkcgitvsqvsnwfgnkrirykkni
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.