PDB entry 2r5n

View 2r5n on RCSB PDB site
Description: Crystal structure of transketolase from Escherichia coli in noncovalent complex with acceptor aldose ribose 5-phosphate
Class: transferase
Keywords: thiamin catalysis, sugar phosphates, acceptor, near attack conformation, cyclic, acyclic, ribose-5-phospate, pyranose, Metal-binding, Thiamine pyrophosphate, Transferase
Deposited on 2007-09-04, released 2007-11-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.164
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transketolase 1
    Species: Escherichia coli [TaxId:562]
    Gene: tktA, tkt
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27302 (Start-662)
      • expression tag (663-666)
    Domains in SCOPe 2.03: d2r5na1, d2r5na2, d2r5na3
  • Chain 'B':
    Compound: Transketolase 1
    Species: Escherichia coli [TaxId:562]
    Gene: tktA, tkt
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27302 (Start-662)
      • expression tag (663)
    Domains in SCOPe 2.03: d2r5nb1, d2r5nb2, d2r5nb3
  • Heterogens: R5P, CA, TPP, EDO, RP5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r5nA (A:)
    mssrkelanairalsmdavqkaksghpgapmgmadiaevlwrdflkhnpqnpswadrdrf
    vlsnghgsmliysllhltgydlpmeelknfrqlhsktpghpevgytagvetttgplgqgi
    anavgmaiaektlaaqfnrpghdivdhytyafmgdgcmmegishevcslagtlklgklia
    fyddngisidghvegwftddtamrfeaygwhvirdidghdaasikraveearavtdkpsl
    lmcktiigfgspnkagthdshgaplgdaeialtreqlgwkyapfeipseiyaqwdakeag
    qakesawnekfaayakaypqeaaeftrrmkgempsdfdakakefiaklqanpakiasrka
    sqnaieafgpllpeflggsadlapsnltlwsgskainedaagnyihygvrefgmtaiang
    islhggflpytstflmfveyarnavrmaalmkqrqvmvythdsiglgedgpthqpveqva
    slrvtpnmstwrpcdqvesavawkygverqdgptalilsrqnlaqqerteeqlaniargg
    yvlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstdafdkqdaayresv
    lpkavtarvaveagiadywykyvglngaivgmttfgesapaellfeefgftvdnvvakak
    ellhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r5nA (A:)
    ssrkelanairalsmdavqkaksghpgapmgmadiaevlwrdflkhnpqnpswadrdrfv
    lsnghgsmliysllhltgydlpmeelknfrqlhsktpghpevgytagvetttgplgqgia
    navgmaiaektlaaqfnrpghdivdhytyafmgdgcmmegishevcslagtlklgkliaf
    yddngisidghvegwftddtamrfeaygwhvirdidghdaasikraveearavtdkpsll
    mcktiigfgspnkagthdshgaplgdaeialtreqlgwkyapfeipseiyaqwdakeagq
    akesawnekfaayakaypqeaaeftrrmkgempsdfdakakefiaklqanpakiasrkas
    qnaieafgpllpeflggsadlapsnltlwsgskainedaagnyihygvrefgmtaiangi
    slhggflpytstflmfveyarnavrmaalmkqrqvmvythdsiglgedgpthqpveqvas
    lrvtpnmstwrpcdqvesavawkygverqdgptalilsrqnlaqqerteeqlaniarggy
    vlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstdafdkqdaayresvl
    pkavtarvaveagiadywykyvglngaivgmttfgesapaellfeefgftvdnvvakake
    llhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2r5nB (B:)
    mssrkelanairalsmdavqkaksghpgapmgmadiaevlwrdflkhnpqnpswadrdrf
    vlsnghgsmliysllhltgydlpmeelknfrqlhsktpghpevgytagvetttgplgqgi
    anavgmaiaektlaaqfnrpghdivdhytyafmgdgcmmegishevcslagtlklgklia
    fyddngisidghvegwftddtamrfeaygwhvirdidghdaasikraveearavtdkpsl
    lmcktiigfgspnkagthdshgaplgdaeialtreqlgwkyapfeipseiyaqwdakeag
    qakesawnekfaayakaypqeaaeftrrmkgempsdfdakakefiaklqanpakiasrka
    sqnaieafgpllpeflggsadlapsnltlwsgskainedaagnyihygvrefgmtaiang
    islhggflpytstflmfveyarnavrmaalmkqrqvmvythdsiglgedgpthqpveqva
    slrvtpnmstwrpcdqvesavawkygverqdgptalilsrqnlaqqerteeqlaniargg
    yvlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstdafdkqdaayresv
    lpkavtarvaveagiadywykyvglngaivgmttfgesapaellfeefgftvdnvvakak
    ellhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r5nB (B:)
    ssrkelanairalsmdavqkaksghpgapmgmadiaevlwrdflkhnpqnpswadrdrfv
    lsnghgsmliysllhltgydlpmeelknfrqlhsktpghpevgytagvetttgplgqgia
    navgmaiaektlaaqfnrpghdivdhytyafmgdgcmmegishevcslagtlklgkliaf
    yddngisidghvegwftddtamrfeaygwhvirdidghdaasikraveearavtdkpsll
    mcktiigfgspnkagthdshgaplgdaeialtreqlgwkyapfeipseiyaqwdakeagq
    akesawnekfaayakaypqeaaeftrrmkgempsdfdakakefiaklqanpakiasrkas
    qnaieafgpllpeflggsadlapsnltlwsgskainedaagnyihygvrefgmtaiangi
    slhggflpytstflmfveyarnavrmaalmkqrqvmvythdsiglgedgpthqpveqvas
    lrvtpnmstwrpcdqvesavawkygverqdgptalilsrqnlaqqerteeqlaniarggy
    vlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstdafdkqdaayresvl
    pkavtarvaveagiadywykyvglngaivgmttfgesapaellfeefgftvdnvvakake
    llh