PDB entry 2r5l

View 2r5l on RCSB PDB site
Description: crystal structure of lactoperoxidase at 2.4a resolution
Deposited on 2007-09-04, released 2007-09-18
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lactoperoxidase
    Species: Capra hircus [TaxId:9925]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, IOD, HEM, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2r5lA (A:)
    swevgcgapvplvtcdeqspyrtitgdcnnrrspalgaanralarwlpaeyedglavpfg
    wtqrktrngfrvplarevsnkivgyldeegvldqnrsllfmqwgqivdhdldfapetelg
    ssehskvqceeycvqgdecfpimfpkndpklktqgkcmpffragfvcptppyqslardqi
    navtsfldaslvygsepslasrlrnlssplglmavnqeawdhglayppfnnvkpspcefi
    nttahvpcfqagdsraseqillatvhtlllrehnrlarelkrlnphwdgemlyqearkil
    gafiqiitfrdylpivlgsemqkwippyqgynnsvdprisnvftfafrfghmevpstvsr
    ldenyqpwgpeaelplhtlffntwriikdggidplvrgllaknsklmnqnkmvtselrnk
    lfqpthkvhgfdlaainlqrcrdhgmpgynswrgfcglsqpktlkglqavlknkvlakkl
    ldlyktpdnidiwiggnaepmvergrvgpllacllgrqfqqirdgdrfwwenpgvftekq
    rdslqkvsfsrlicdnthitkvplhafqannyphdfvdcsavdkldlspwasren