PDB entry 2r5e

View 2r5e on RCSB PDB site
Description: Aedes kynurenine aminotransferase in complex with glutamine
Class: transferase
Keywords: alpha and beta protein, pyridoxal 5-phosphate, Aminotransferase, Transferase
Deposited on 2007-09-03, released 2008-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.203
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kynurenine aminotransferase
    Species: Aedes aegypti [TaxId:7159]
    Gene: KAT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2r5ea_
  • Chain 'B':
    Compound: Kynurenine aminotransferase
    Species: Aedes aegypti [TaxId:7159]
    Gene: KAT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2r5eb_
  • Heterogens: QLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r5eA (A:)
    msstsnetmhnkfdlpkryqgstksvwveyiqlaaqykplnlgqgfpdyhapkyalnala
    aaanspdplanqytrgfghprlvqalsklysqlvdrtinpmtevlvtvgayealyatiqg
    hvdegdeviiiepffdcyepmvkaaggiprfiplkpnktggtissadwvldnnelealfn
    ektkmiiintphnplgkvmdraelevvanlckkwnvlcvsdevyehmvfepfehirictl
    pgmwertitigsagktfsltgwkigwaygpeallknlqmvhqncvytcatpiqeaiavgf
    etelkrlkspecyfnsisgelmakrdymasflaevgmnptvpqggyfmvadwssldskvd
    ltqetdarkdyrftkwmtksvglqgippsafysepnkhlgedfvrycffkkdenlqkaae
    ilrkwkgss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r5eA (A:)
    nkfdlpkryqgstksvwveyiqlaaqykplnlgqgfpdyhapkyalnalaaaanspdpla
    nqytrgfghprlvqalsklysqlvdrtinpmtevlvtvgayealyatiqghvdegdevii
    iepffdcyepmvkaaggiprfiplkpnktggtissadwvldnnelealfnektkmiiint
    phnplgkvmdraelevvanlckkwnvlcvsdevyehmvfepfehirictlpgmwertiti
    gsagktfsltgwkigwaygpeallknlqmvhqncvytcatpiqeaiavgfetelkrlksp
    ecyfnsisgelmakrdymasflaevgmnptvpqggyfmvadwssldskvdltqetdarkd
    yrftkwmtksvglqgippsafysepnkhlgedfvrycffkkdenlqkaaeilrkwkgss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2r5eB (B:)
    msstsnetmhnkfdlpkryqgstksvwveyiqlaaqykplnlgqgfpdyhapkyalnala
    aaanspdplanqytrgfghprlvqalsklysqlvdrtinpmtevlvtvgayealyatiqg
    hvdegdeviiiepffdcyepmvkaaggiprfiplkpnktggtissadwvldnnelealfn
    ektkmiiintphnplgkvmdraelevvanlckkwnvlcvsdevyehmvfepfehirictl
    pgmwertitigsagktfsltgwkigwaygpeallknlqmvhqncvytcatpiqeaiavgf
    etelkrlkspecyfnsisgelmakrdymasflaevgmnptvpqggyfmvadwssldskvd
    ltqetdarkdyrftkwmtksvglqgippsafysepnkhlgedfvrycffkkdenlqkaae
    ilrkwkgss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r5eB (B:)
    nkfdlpkryqgstksvwveyiqlaaqykplnlgqgfpdyhapkyalnalaaaanspdpla
    nqytrgfghprlvqalsklysqlvdrtinpmtevlvtvgayealyatiqghvdegdevii
    iepffdcyepmvkaaggiprfiplkpnktggtissadwvldnnelealfnektkmiiint
    phnplgkvmdraelevvanlckkwnvlcvsdevyehmvfepfehirictlpgmwertiti
    gsagktfsltgwkigwaygpeallknlqmvhqncvytcatpiqeaiavgfetelkrlksp
    ecyfnsisgelmakrdymasflaevgmnptvpqggyfmvadwssldskvdltqetdarkd
    yrftkwmtksvglqgippsafysepnkhlgedfvrycffkkdenlqkaaeilrkwkgss