PDB entry 2r5d

View 2r5d on RCSB PDB site
Description: structure of the gp41 n-trimer in complex with the hiv entry inhibitor pie7
Deposited on 2007-09-03, released 2007-10-02
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gp41 N-peptide
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 2R5D (0-44)
  • Chain 'B':
    Compound: gp41 N-peptide
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 2R5D (0-44)
  • Chain 'C':
    Compound: gp41 N-peptide
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 2R5D (0-44)
  • Chain 'H':
    Compound: HIV entry inhibitor PIE7
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'K':
    Compound: HIV entry inhibitor PIE7
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'L':
    Compound: HIV entry inhibitor PIE7
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: GOL, SO4, EPE, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2r5dA (A:)
    rmkqiedkieeieskqkkieneiarikkllqltvwgikqlqaril
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >2r5dB (B:)
    rmkqiedkieeieskqkkieneiarikkllqltvwgikqlqaril
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >2r5dC (C:)
    rmkqiedkieeieskqkkieneiarikkllqltvwgikqlqaril
    

  • Chain 'H':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.