PDB entry 2r5b

View 2r5b on RCSB PDB site
Description: structure of the gp41 n-trimer in complex with the hiv entry inhibitor pie7
Deposited on 2007-09-03, released 2007-10-02
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: gp41 N-peptide
  Species: synthetic construct, synthetic [TaxId:32630]
  Database cross-references and differences (RAF-indexed):
  • PDB 2R5B (0-44)
• Chain 'B':
  Compound: gp41 N-peptide
  Species: synthetic construct, synthetic [TaxId:32630]
  Database cross-references and differences (RAF-indexed):
  • PDB 2R5B (0-44)
• Chain 'C':
  Compound: gp41 N-peptide
  Species: synthetic construct, synthetic [TaxId:32630]
  Database cross-references and differences (RAF-indexed):
  • PDB 2R5B (0-44)
• Chain 'H':
  Compound: HIV entry inhibitor PIE7
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Chain 'K':
  Compound: HIV entry inhibitor PIE7
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Chain 'L':
  Compound: HIV entry inhibitor PIE7
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >2r5bA (A:)
  rmkqiedkieeieskqkkieneiarikkllqltvwgikqlqaril
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records:
  

  >2r5bB (B:)
  rmkqiedkieeieskqkkieneiarikkllqltvwgikqlqaril
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records:
  

  >2r5bC (C:)
  rmkqiedkieeieskqkkieneiarikkllqltvwgikqlqaril
  

  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'K':
  No sequence available.
  
  
• Chain 'L':
  No sequence available.