PDB entry 2r59

View 2r59 on RCSB PDB site
Description: Leukotriene A4 hydrolase complexed with inhibitor RB3041
Class: hydrolase
Keywords: transition state, analogue peptide, hydrolysis, Alternative splicing, Cytoplasm, Hydrolase, Leukotriene biosynthesis, Metal-binding, Metalloprotease, Multifunctional enzyme, Protease, Zinc
Deposited on 2007-09-03, released 2008-08-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Leukotriene A-4 hydrolase
    Species: HOMO SAPIENS
    Gene: LTA4H, LTA4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2r59a1, d2r59a2, d2r59a3
  • Heterogens: ZN, YB, PH0, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r59A (A:)
    hhhhhhpeivdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvl
    dtkdltiekvvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssa
    lqwltpeqtsgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsair
    dgetpdpedpsrkiykfiqkvpipcylialvvgalesrqigprtlvwsekeqveksayef
    setesmlkiaedlggpyvwgqydllvlppsfpyggmenpcltfvtptllagdkslsnvia
    heishswtgnlvtnktwdhfwlneghtvylerhicgrlfgekfrhfnalggwgelqnsvk
    tfgethpftklvvdltdidpdvayssvpyekgfallfyleqllggpeiflgflkayvekf
    syksittddwkdflysyfkdkvdvlnqvdwnawlyspglppikpnydmtltnacialsqr
    witakeddlnsfnatdlkdlsshqlneflaqtlqraplplghikrmqevynfnainnsei
    rfrwlrlciqskwedaiplalkmateqgrmkftrplfkdlaafdkshdqavrtyqehkas
    mhpvtamlvgkdlkvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r59A (A:)
    peivdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtkdlt
    iekvvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqwltp
    eqtsgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdgetpd
    pedpsrkiykfiqkvpipcylialvvgalesrqigprtlvwsekeqveksayefsetesm
    lkiaedlggpyvwgqydllvlppsfpyggmenpcltfvtptllagdkslsnviaheishs
    wtgnlvtnktwdhfwlneghtvylerhicgrlfgekfrhfnalggwgelqnsvktfgeth
    pftklvvdltdidpdvayssvpyekgfallfyleqllggpeiflgflkayvekfsyksit
    tddwkdflysyfkdkvdvlnqvdwnawlyspglppikpnydmtltnacialsqrwitake
    ddlnsfnatdlkdlsshqlneflaqtlqraplplghikrmqevynfnainnseirfrwlr
    lciqskwedaiplalkmateqgrmkftrplfkdlaafdkshdqavrtyqehkasmhpvta
    mlvgkdlkvd