PDB entry 2r56

View 2r56 on RCSB PDB site
Description: Crystal Structure of a Recombinant IgE Fab Fragment in Complex with Bovine Beta-Lactoglobulin Allergen
Class: immune system
Keywords: Allergen, IgE, Epitope, Immunocomplex, Lipocalin, Fab, Milk protein, Polymorphism, Retinol-binding, Secreted, Transport, IMMUNE SYSTEM
Deposited on 2007-09-03, released 2007-11-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.246
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-lactoglobulin
    Species: Bos taurus [TaxId:9913]
    Gene: LGB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2r56a_
  • Chain 'B':
    Compound: beta-lactoglobulin
    Species: Bos taurus [TaxId:9913]
    Gene: LGB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2r56b_
  • Chain 'H':
    Compound: IgE Fab Fragment, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2R56 (0-220)
  • Chain 'I':
    Compound: IgE Fab Fragment, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2R56 (0-220)
  • Chain 'L':
    Compound: IgE Fab Fragment, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2R56 (0-210)
    Domains in SCOPe 2.04: d2r56l1, d2r56l2
  • Chain 'M':
    Compound: IgE Fab Fragment, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2R56 (0-210)
    Domains in SCOPe 2.04: d2r56m1, d2r56m2
  • Heterogens: LMT

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r56A (A:)
    livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
    wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacq
    clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r56A (A:)
    tqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqkwen
    gecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacqclv
    rtpevddealekfdkalkalpmhirlsfnptqleeqchi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2r56B (B:)
    livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
    wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacq
    clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r56B (B:)
    tqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqkwen
    gecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacqclv
    rtpevddealekfdkalkalpmhirlsfnptqleeqchi
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2r56L (L:)
    divmtqspsslsasvgdrvtitcrasqgissrlawyqqkpgkapklliyaasslqsgvps
    rfsgsgsgteftltisslqpedfatyycqqyhsypwtfgqgtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2r56M (M:)
    divmtqspsslsasvgdrvtitcrasqgissrlawyqqkpgkapklliyaasslqsgvps
    rfsgsgsgteftltisslqpedfatyycqqyhsypwtfgqgtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr