PDB entry 2r4q

View 2r4q on RCSB PDB site
Description: The structure of a domain of fruA from Bacillus subtilis
Class: transferase, transport protein
Keywords: Phosphotransferase system, Fructose specific IIB subunit, pfam02379, Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, Membrane, Sugar transport, Transmembrane, Transport, TRANSFERASE, TRANSPORT PROTEIN
Deposited on 2007-08-31, released 2007-09-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphotransferase system (PTS) fructose-specific enzyme IIABC component
    Species: BACILLUS SUBTILIS [TaxId:224308]
    Gene: fruA, BSU14400
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71012 (3-105)
      • expression tag (2)
    Domains in SCOPe 2.08: d2r4qa1, d2r4qa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r4qA (A:)
    snakilavtacptgiahtfmaadalkekakelgveikvetngssgikhkltaqeiedapa
    iivaadkqvemerfkgkrvlqvpvtagirrpqeliekamnqdapiy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r4qA (A:)
    akilavtacptghtfmaadalkekakelgveikvetngssgikhkltaqeiedapaiiva
    adkqvemerfkgkrvlqvpvtagirrpqeliekamnqdapiy