PDB entry 2r49

View 2r49 on RCSB PDB site
Description: Mutational and Structural Studies of E85I Reveal the Flexible Loops of Fibrobacter succinogenes 1,3-1,4-beta-D-GlucanaseGlucanase
Class: hydrolase
Keywords: 1,3-1,4-beta-D-Glucanase, jellyroll beta-sandwich Ca ion, Glycosidase, Hydrolase
Deposited on 2007-08-30, released 2008-09-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.198
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Beta-glucanase
  Species: Fibrobacter succinogenes [TaxId:833]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P17989 (0-240)
    • engineered (82)
  Domains in SCOPe 2.06: d2r49a_
• Heterogens: CA, CS, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2r49A (A:)
  sakdfsgaelytleevqygkfearmkmaaasgtvssmflyqngseiadgrpwvevdievl
  gknpgsfqsniitgkagaqktsikhhavspaadqafhtyglewtpnyvrwtvdgqevrkt
  eggqvsnltgtqglrfnlwssesaawvgqfdesklplfqfinwvkvykytpgqgeggsdf
  tldwtdnfdtfdgsrwgkgdwtfdgnrvdltdkniysrdgmlilaltrkgqesfngqvpr
  d