PDB entry 2r48

View 2r48 on RCSB PDB site
Description: Crystal structure of the fructose specific IIB subunit of PTS system from Bacillus subtilis subsp. subtilis str. 168
Class: transferase, transport protein
Keywords: PTS system, phosphotransferase system, fructose specific IIB subunit, pfam02379, PSI-2, MCSG, Structural Genomics, Protein Structure Initiative, Midwest Center for Structural Genomics, Membrane, Sugar transport, Transmembrane, Transport, TRANSFERASE, TRANSPORT PROTEIN
Deposited on 2007-08-30, released 2007-09-11
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.186
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphotransferase system (PTS) mannose-specific enzyme IIBCA component
    Species: Bacillus subtilis subsp. subtilis [TaxId:224308]
    Gene: manP, BSU12010
    Database cross-references and differences (RAF-indexed):
    • Uniprot O31645 (3-105)
      • expression tag (1-2)
    Domains in SCOPe 2.03: d2r48a1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r48A (A:)
    snakllaitscpngiahtymaaenlqkaadrlgvsikvetqggigvenklteeeireada
    iiiaadrsvnkdrfigkkllsvgvqdgirkpeeliqkalngdipvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r48A (A:)
    nakllaitscpngiahtymaaenlqkaadrlgvsikvetqggigvenklteeeireadai
    iiaadrsvnkdrfigkkllsvgvqdgirkpeeliqkalngdipvy