PDB entry 2r48

View 2r48 on RCSB PDB site
Description: Crystal structure of the fructose specific IIB subunit of PTS system from Bacillus subtilis subsp. subtilis str. 168
Class: transferase, transport protein
Keywords: PTS system, phosphotransferase system, fructose specific IIB subunit, pfam02379, PSI-2, MCSG, Structural Genomics, Protein Structure Initiative, Midwest Center for Structural Genomics, Membrane, Sugar transport, Transmembrane, Transport, TRANSFERASE, TRANSPORT PROTEIN
Deposited on 2007-08-30, released 2007-09-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.186
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phosphotransferase system (PTS) mannose-specific enzyme IIBCA component
  Species: Bacillus subtilis subsp. subtilis [TaxId:224308]
  Gene: manP, BSU12010
  Database cross-references and differences (RAF-indexed):
  • Uniprot O31645 (3-105)
    • expression tag (1-2)
  Domains in SCOPe 2.08: d2r48a1, d2r48a2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2r48A (A:)
  snakllaitscpngiahtymaaenlqkaadrlgvsikvetqggigvenklteeeireada
  iiiaadrsvnkdrfigkkllsvgvqdgirkpeeliqkalngdipvy
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2r48A (A:)
  nakllaitscpngiahtymaaenlqkaadrlgvsikvetqggigvenklteeeireadai
  iiaadrsvnkdrfigkkllsvgvqdgirkpeeliqkalngdipvy