PDB entry 2r44

View 2r44 on RCSB PDB site
Description: crystal structure of a putative atpase (chu_0153) from cytophaga hutchinsonii atcc 33406 at 2.00 a resolution
Deposited on 2007-08-30, released 2007-09-18
The last revision was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Cytophaga hutchinsonii [TaxId:269798]
    Gene: YP_676785.1, CHU_0153
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q11YS1 (1-End)
      • leader sequence (0)
  • Heterogens: PO4, PG4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2r44A (A:)
    gmelksaeekslyyrnkikevidevgkvvvgqkyminrlligictgghillegvpglakt
    lsvntlaktmdldfhriqftpdllpsdligtmiynqhkgnfevkkgpvfsnfiladevnr
    spakvqsallecmqekqvtigdttypldnpflvlatqnpveqegtyplpeaqvdrfmmki
    hltyldkeselevmrrvsnmnfnyqvqkivskndvleirneinkvtiseslekyiielvf
    atrfpaeygleaeasyilygastraainlnrvakamaffnnrdyvlpedikevaydilnh
    riilnyeaeaegistrqiietilrkvnitka
    

    Sequence, based on observed residues (ATOM records):
    >2r44A (A:)
    gmelksaeekslyyrnkikevidevgkvvvgqkyminrlligictgghillegvpglakt
    lsvntlaktmdldfhriqftpdllpsdligtmiynqhkgnfevkkgpvfsnfiladevnr
    spakvqsallecmqekqvtigdttypldnpflvlatqnpveqegtyplpeaqvdrfmmki
    hltyldkeselevmrrvsnmnfnyqvqkivskndvleirneinkvtiseslekyiielvf
    atrfpaeygleaeasyilygastraainlnrvakamaffnnrdyvlpedikevaydilnh
    riilnyeaeaegistrqiietilrkvnitk