PDB entry 2r43

View 2r43 on RCSB PDB site
Description: I50V HIV-1 protease in complex with an amino decorated pyrrolidine-based inhibitor
Class: hydrolase
Keywords: protein-ligand complex, HYDROLASE
Deposited on 2007-08-30, released 2008-09-09
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: 0.198
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5RZ08 (0-98)
    • engineered (49)
  Domains in SCOPe 2.03: d2r43a_
• Chain 'B':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5RZ08 (0-98)
    • engineered (49)
  Domains in SCOPe 2.03: d2r43b_
• Heterogens: CL, G3G, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2r43A (A:)
  pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggvggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2r43B (B:)
  pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggvggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf