PDB entry 2r43
View 2r43 on RCSB PDB site
Description: I50V HIV-1 protease in complex with an amino decorated pyrrolidine-based inhibitor
Class: hydrolase
Keywords: protein-ligand complex, HYDROLASE
Deposited on
2007-08-30, released
2008-09-09
The last revision prior to the SCOPe 2.08 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-25.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: 0.198
AEROSPACI score: 0.58
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: pol
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2r43a_ - Chain 'B':
Compound: Protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: pol
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2r43b_ - Heterogens: CL, G3G, GOL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2r43A (A:)
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggvggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2r43B (B:)
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggvggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigctlnf