PDB entry 2r3x

View 2r3x on RCSB PDB site
Description: Crystal structure of an R15L hGSTA1-1 mutant complexed with S-hexyl-glutathione
Class: transferase
Keywords: human Alpha class glutathione transferase 1-1, S-hexyl glutathione, X-ray crystal structure, TRANSFERASE
Deposited on 2007-08-30, released 2007-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08263 (Start-221)
      • engineered (14)
    Domains in SCOPe 2.07: d2r3xa1, d2r3xa2
  • Chain 'B':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08263 (Start-221)
      • engineered (14)
    Domains in SCOPe 2.07: d2r3xb1, d2r3xb2
  • Heterogens: GTX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r3xA (A:)
    maekpklhyfnarglmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemilllpvcppeekdak
    lalikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkppmdeksleearkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r3xA (A:)
    aekpklhyfnarglmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemilllpvcppeekdakl
    alikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkppmdeksleearkifrf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2r3xB (B:)
    maekpklhyfnarglmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemilllpvcppeekdak
    lalikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkppmdeksleearkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r3xB (B:)
    kpklhyfnarglmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveidgm
    klvqtrailnyiaskynlygkdikeralidmyiegiadlgemilllpvcppeekdaklal
    ikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpllka
    lktrisnlptvkkflqpgsprkppmdeksleearkifrf