PDB entry 2r3t

View 2r3t on RCSB PDB site
Description: I50V HIV-1 protease mutant in complex with a carbamoyl decorated pyrrolidine-based inhibitor
Class: hydrolase
Keywords: protein-ligand complex, Aspartyl protease, Hydrolase, Protease
Deposited on 2007-08-30, released 2008-09-02
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.193
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5RZ08 (0-98)
      • engineered (49)
    Domains in SCOPe 2.03: d2r3ta_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5RZ08 (0-98)
      • engineered (49)
    Domains in SCOPe 2.03: d2r3tb_
  • Heterogens: CL, G4G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2r3tA (A:)
    pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggvggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2r3tB (B:)
    pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggvggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigctlnf