PDB entry 2r3t
View 2r3t on RCSB PDB site
Description: I50V HIV-1 protease mutant in complex with a carbamoyl decorated pyrrolidine-based inhibitor
Class: hydrolase
Keywords: protein-ligand complex, Aspartyl protease, Hydrolase, Protease
Deposited on
2007-08-30, released
2008-09-02
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-06-09, with a file datestamp of
2009-06-05.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.193
AEROSPACI score: 0.5
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: pol
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2r3ta_ - Chain 'B':
Compound: Protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: pol
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2r3tb_ - Heterogens: CL, G4G, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2r3tA (A:)
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggvggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2r3tB (B:)
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggvggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigctlnf