PDB entry 2r3c

View 2r3c on RCSB PDB site
Description: Structure of the gp41 N-peptide in complex with the HIV entry inhibitor PIE1
Class: viral protein/viral protein inhibitor
Keywords: HIV, inhibitor, viral entry, PIE, VIRAL PROTEIN, VIRAL PROTEIN-VIRAL PROTEIN INHIBITOR complex
Deposited on 2007-08-29, released 2007-10-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: gp41 N-peptide
  Species: synthetic construct, synthetic [TaxId:32630]
  Database cross-references and differences (RAF-indexed):
  • PDB 2R3C (0-44)
  Domains in SCOPe 2.08: d2r3ca1
• Chain 'B':
  Compound: gp41 N-peptide
  Species: synthetic construct, synthetic [TaxId:32630]
  Database cross-references and differences (RAF-indexed):
  • PDB 2R3C (Start-44)
• Chain 'C':
  Compound: HIV entry inhibitor PIE1
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Chain 'D':
  Compound: HIV entry inhibitor PIE1
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Heterogens: YT3, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2r3cA (A:)
  rmkqiedkieeieskqkkieneiarikkllqltvwgikqlqaril
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.