PDB entry 2r38

View 2r38 on RCSB PDB site
Description: I84V HIV-1 protease mutant in complex with a carbamoyl decorated pyrrolidine-based inhibitor
Class: hydrolase
Keywords: protein-ligand complex, Aspartyl protease, Hydrolase, Protease
Deposited on 2007-08-29, released 2008-09-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.204
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5RZ08 (0-98)
    • engineered (83)
  Domains in SCOPe 2.08: d2r38a_
• Chain 'B':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5RZ08 (0-98)
    • engineered (83)
  Domains in SCOPe 2.08: d2r38b_
• Heterogens: CL, G4G, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2r38A (A:)
  pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvnvigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2r38B (B:)
  pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvnvigrnlltqigctlnf