PDB entry 2r35

View 2r35 on RCSB PDB site
Description: Crystal structure of RB human arg-insulin
Class: hormone
Keywords: hormone, glucose utilisation, t3r3 conformation
Deposited on 2007-08-29, released 2008-09-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-01-13, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.243
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: insulin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-21)
• Chain 'B':
  Compound: insulin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-End)
  Domains in SCOPe 2.08: d2r35b1
• Chain 'C':
  Compound: insulin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (Start-21)
• Chain 'D':
  Compound: insulin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
  Domains in SCOPe 2.08: d2r35d1
• Heterogens: RB, NA, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >2r35B (B:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2r35B (B:)
  fvnqhlcgshlvealylvcgergffytp
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2r35D (D:)
  fvnqhlcgshlvealylvcgergffytpkt