PDB entry 2r33

View 2r33 on RCSB PDB site
Description: Crystal structure of a Bowman-Birk inhibitor from Vigna unguiculata seeds
Class: plant protein
Keywords: BOWMAN-BIRK PROTEASE INHIBITOR, VIGNA UNGUICULATA, PLANT-PIS, PROTEIN-PROTEIN INTERACTIONS, Serine protease inhibitor, PLANT PROTEIN
Deposited on 2007-08-28, released 2007-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.191
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bowman-Birk type seed trypsin and chymotrypsin inhibitor
    Species: Vigna unguiculata [TaxId:3917]
    Database cross-references and differences (RAF-indexed):
    • PDB 2R33
    Domains in SCOPe 2.07: d2r33a1
  • Chain 'B':
    Compound: Bowman-Birk type seed trypsin and chymotrypsin inhibitor
    Species: Vigna unguiculata [TaxId:3917]
    Database cross-references and differences (RAF-indexed):
    • PDB 2R33
    Domains in SCOPe 2.07: d2r33b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r33A (A:)
    sghhedstdepsessepccdscvctksippqchctnirlnschsgcksclctfsipgscr
    cldianfcykpcks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r33A (A:)
    pccdscvctksippqchctnirlnschsgcksclctfsgscrcldianfcykpck
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2r33B (B:)
    sghhedstdepsessepccdscvctksippqchctnirlnschsgcksclctfsipgscr
    cldianfcykpcks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r33B (B:)
    pccdscvctksippqchctnirlnschsgcksclctfsipgscrcldianfcykpck