PDB entry 2r30

View 2r30 on RCSB PDB site
Description: Crystal Structure of human GITRL mutant
Class: cytokine
Keywords: GITRL, Glucocorticoid-Induced TNF Receptor Ligand, Cytokine, Glycoprotein, Membrane, Signal-anchor, Transmembrane
Deposited on 2007-08-28, released 2007-11-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor necrosis factor ligand superfamily member 18
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFSF18, AITRL, GITRL, TL6
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UNG2
      • engineered (58)
    Domains in SCOPe 2.08: d2r30a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r30A (A:)
    gshmetakepcmakfgplpskwqmasseppcvnkvsdwkleilqnglyliygqvapnaay
    ndvapfevrlyknkdmiqtltnkskiqnvggtyelhvgdtidlifnsehqvlknntywgi
    illanpqfis
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r30A (A:)
    pcmakfgplpskwqmasseppcvnkvsdwkleilqnglyliygqvapnaayndvapfevr
    lyknkdmiqtltnkskiqnvggtyelhvgdtidlifnsehqvlknntywgiillan