PDB entry 2r2z

View 2r2z on RCSB PDB site
Description: The crystal structure of a hemolysin domain from Enterococcus faecalis V583
Class: toxin
Keywords: APC85144, hemolysin domain, Enterococcus faecalis V583, structure initiative, midwest center for structural genomics, MCSG, PSI-2, Protein Structure Initiative, Membrane, Transmembrane, TOXIN
Deposited on 2007-08-28, released 2007-09-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.155
AEROSPACI score: 0.83 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemolysin
    Species: Enterococcus faecalis [TaxId:226185]
    Gene: EF_0700
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2r2za1
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r2zA (A:)
    snadevenlytqvadneylvqgrmlidefnevfetdlhmsdvdtmagylitalgtipdeg
    ekpsfevgnikltaeemegtrllvlrvhfydee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r2zA (A:)
    nlytqvadneylvqgrmlidefnevfetdlhmsdvdtmagylitalgtipdegekpsfev
    gnikltaeemegtrllvlrvhfyd