PDB entry 2r2y

View 2r2y on RCSB PDB site
Description: Crystal structure of the proteasomal Rpn13 PRU-domain
Deposited on 2007-08-28, released 2008-05-13
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.215
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein ADRM1
    Species: Mus musculus [TaxId:10090]
    Gene: Adrm1, Gp110
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2r2yA (A:)
gpgsttsgalfpslvpgsrgsstkylvefragkmslkgttvtpdkrkglvyiqqtddsli
hfcwkdrtsgtveddliifpddcefkrvpqcpsgrvyvlkfkagskrlffwmqepktdqd
eehcrkvneclnnppmpgslgasgssghelsal

    Sequence, based on observed residues (ATOM records):
    >2r2yA (A:)
ylvefragkmslkgttvtpdkrkglvyiqqtddslihfcwkdrtsgtveddliifpddce
fkrvpqcpsgrvyvlkfkagskrlffwmqepktdqdeehcrkvneclnn