PDB entry 2r2x

View 2r2x on RCSB PDB site
Description: Ricin A-chain (recombinant) complex with Urea
Class: hydrolase
Keywords: Ricin, Ricinus communis, N-glycosidase, Toxin, Glycoprotein, Hydrolase, Lectin, Plant defense, Protein synthesis inhibitor
Deposited on 2007-08-28, released 2007-11-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-07-21, with a file datestamp of 2009-07-17.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.252
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ricin a chain
    Species: Ricinus communis [TaxId:3988]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2r2xa_
  • Heterogens: SO4, URE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r2xA (A:)
    mifpkqypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfil
    velsnhaelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfaf
    ggnydrleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaa
    rfqyiegemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngsk
    fsvydvsilipiialmvyrcapppssqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r2xA (A:)
    ypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvelsnh
    aelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggnydr
    leqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaarfqyie
    gemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvydv
    silipiialmvyrcappp