PDB entry 2r2t

View 2r2t on RCSB PDB site
Description: d(ATTTAGTTAACTAAAT) complexed with MMLV RT catalytic fragment
Class: transferase/DNA
Keywords: bleomycin, drug-DNA complex, protein-DNA complex, MMLV RT, Aspartyl protease, DNA integration, DNA recombination, Endonuclease, Hydrolase, Multifunctional enzyme, Nuclease, Nucleotidyltransferase, Protease, RNA-directed DNA polymerase, Transferase, transferase/DNA COMPLEX
Deposited on 2007-08-27, released 2008-07-22
The last revision prior to the SCOP 1.75 freeze date was dated 2008-07-22, with a file datestamp of 2008-07-18.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.224
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: reverse transcriptase
  Species: Moloney murine leukemia virus [TaxId:11801]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03355 (0-254)
  Domains in SCOP 1.75: d2r2ta1
• Chain 'B':
  Compound: DNA (5'-d(*dap*dtp*dtp*dtp*dap*dgp*dtp*dt)-3')
  
• Chain 'G':
  Compound: DNA (5'-d(p*dap*dap*dcp*dtp*dap*dap*dap*dt)-3')
  
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2r2tA (A:)
  twlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiqrlld
  qgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsglppsh
  qwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlfdeal
  hrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakkaqicq
  kqvkylgyllkegqr
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.