PDB entry 2r2t

View 2r2t on RCSB PDB site
Description: d(ATTTAGTTAACTAAAT) complexed with MMLV RT catalytic fragment
Class: transferase/DNA
Keywords: bleomycin, drug-DNA complex, protein-DNA complex, MMLV RT, Aspartyl protease, DNA integration, DNA recombination, Endonuclease, Hydrolase, Multifunctional enzyme, Nuclease, Nucleotidyltransferase, Protease, RNA-directed DNA polymerase, Transferase, transferase-DNA COMPLEX
Deposited on 2007-08-27, released 2008-07-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: reverse transcriptase
    Species: Moloney murine leukemia virus [TaxId:11801]
    Gene: pol
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2r2ta_
  • Chain 'B':
    Compound: DNA (5'-d(*dap*dtp*dtp*dtp*dap*dgp*dtp*dt)-3')
  • Chain 'G':
    Compound: DNA (5'-d(p*dap*dap*dcp*dtp*dap*dap*dap*dt)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2r2tA (A:)
    twlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiqrlld
    qgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsglppsh
    qwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlfdeal
    hrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakkaqicq
    kqvkylgyllkegqr
    

  • Chain 'B':
    No sequence available.

  • Chain 'G':
    No sequence available.