PDB entry 2r2q

View 2r2q on RCSB PDB site
Description: Crystal structure of human Gamma-Aminobutyric Acid Receptor-Associated Protein-like 1 (GABARAP1), Isoform CRA_a
Class: signaling protein, protein transport
Keywords: autophagy, ubiquitin homolog, Structural Genomics Consortium, SGC, Microtubule, SIGNALING PROTEIN, PROTEIN TRANSPORT
Deposited on 2007-08-27, released 2007-09-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gamma-aminobutyric acid receptor-associated protein-like 1
    Species: Homo sapiens [TaxId:9606]
    Gene: GABARAPL1, GEC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H0R8 (1-109)
      • expression tag (0)
    Domains in SCOPe 2.08: d2r2qa1, d2r2qa2
  • Chain 'B':
    Compound: Gamma-aminobutyric acid receptor-associated protein-like 1
    Species: Homo sapiens [TaxId:9606]
    Gene: GABARAPL1, GEC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H0R8 (1-109)
      • expression tag (0)
    Domains in SCOPe 2.08: d2r2qb1, d2r2qb2
  • Heterogens: UNX, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2r2qA (A:)
    gfqykedhpfeyrkkegekirkkypdrvpvivekapkarvpdldkrkylvpsdltvgqfy
    flirkrihlrpedalfffvnntipptsatmgqlyednheedyflyvaysd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2r2qB (B:)
    gfqykedhpfeyrkkegekirkkypdrvpvivekapkarvpdldkrkylvpsdltvgqfy
    flirkrihlrpedalfffvnntipptsatmgqlyednheedyflyvaysd